Recombinant Rat Adenosine receptor A2b (Adora2b)

Code: CSB-CF001377RA
Size:
20μg
20μg100μg
US$4979
Quantity:
Express system: in vitro E.coli expression system
Species: Rattus norvegicus (Rat)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
Adora2b
Uniprot NO.
Alternative Names
Adora2b; Adenosine receptor A2b
Species
Rattus norvegicus (Rat)
Source
in vitro E.coli expression system
Expression Region
1-332
Target Protein Sequence
MQLETQDALYVALELVIAALAVAGNVLVCAAVGASSALQTPTNYFLVSLATADVAVGLFA IPFAITISLGFCTDFHSCLFLACFVLVLTQSSIFSLLAVAVDRYLAIRVPLRYKGLVTGT RARGIIAVLWVLAFGIGLTPFLGWNSKDRATSNCTEPGDGITNKSCCPVKCLFENVVPMS YMVYFNFFGCVLPPLLIMMVIYIKIFMVACKQLQHMELMEHSRTTLQREIHAAKSLAMIV GIFALCWLPVHAINCITLFHPALAKDKPKWVMNVAILLSHANSVVNPIVYAYRNRDFRYS FHRIISRYVLCQTDTKGGSGQAGGQSTFSLSL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Receptor for adenosine. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.
Gene References into Functions
  1. these results suggested that activation of A2b receptor could be a novel therapeutic approach to high glucose-induced cardiomyocyte injury. PMID:29626279
  2. Increased A2BAR and adenosine following unilateral lung ischemia as well as more ronchiolitis obliterans organizing pneumonia in A2BAR mutant rats implicate a protective role for A2BAR signaling in countering ischemic lung injury PMID:28266889
  3. renal fibroblasts express a functional AR1 receptor that inhibits cyclic AMP (cAMP) upon stimulation, leading to a functional AR2B receptor that increases cAMP upon stimulation. PMID:27466291
  4. Our data indicate varying roles for A(2B)AR signaling in regulating blood pressure in SS rats PMID:26385692
  5. A2B receptors are downregulated during aging, leading to a reduced adenosine-mediated detrusor relaxation. PMID:25728851
  6. The findings suggest that adenosine plays a role in signaling transmission via A2bR between taste cells in rats. PMID:24327108
  7. that stimulation of A2B receptors protects against trauma and hemorrhagic shock -induced lung and muscle injury. PMID:23584760
  8. Nitric oxide synthase/K+ channel cascade triggers the adenosine A(2B) receptor-sensitive renal vasodilation in female rats PMID:23396225
  9. The role of the A2B adenosine receptor (AR) in prostate cell death and growth was studied PMID:23315335
  10. Paracrine Ado A2b receptor signaling contributes to stimulus-evoked catecholamine secretion in hypoxic carotid body chemoreceptors. PMID:23885058
  11. Hypoxia induced serotonin synthesis and secretion is amplified by ADORA2B signaling via MAPK/CREB and TPH-1 activation. PMID:23638125
  12. We determined that the adenosine A(2B) receptor (A(2B)AR) mediates VEGF overproduction in ex vivo glomeruli exposed to high glucose concentration, requiring PKCalpha and Erk1/2 activation. PMID:23069939
  13. 2',3'-cAMP inhibits proliferation of vascular smooth muscle cells from the aorta and coronary arteries. This effect is due in part to metabolism of 2',3'-cAMP to adenosine, with engagement of the A2B receptor. PMID:21622827
  14. the present study demonstrates that activation of A(2B)AR is strongly cardioprotective in rat heart and suppresses transition pores in isolated cardiomyocytes PMID:21246204
  15. Endogenously produced luminal surface adenosine increases HCO3- secretion in an intact intestinal epithelium in vivo through the activation of A2B receptors. PMID:20805305
  16. The A(2B)AR may contribute to the later stages of ischemic preconditioning dependent on the induction of stress-responsive genes. PMID:20797398
  17. A(2A) and A(2B) receptors are functionally expressed in juxtamedullary afferent arterioles. The powerful vasodilating action of adenosine predominantly involves A(2B) receptor activation, which counteracts A(1) receptor-mediated vasoconstriction. PMID:20462966
  18. A(2B) receptors may play a critical role in regulating vascular remodeling PMID:11882603
  19. 1,8-disubstituted xanthine derivatives: synthesis of potent A2B-selective adenosine receptor antagonists PMID:11906291
  20. Changes in expression of adenosine type-2B (A2B)receptors and a related intracellular second messenger were noted during chronic brain inflammation and following treatment with the NSAID drug flurbiprofen and its nitric oxide-donating derivative, HCT1026 PMID:12807441
  21. The results show that adenylyl cyclase activation by adenosine and phosphorylation of CREB, but not ERK1/2 or p38, is mainly mediated via the adenosine A(2B) receptor. PMID:12849998
  22. A2bR are critically involved in adenosine-mediated inhibition of cardiac fibroblast functions. PMID:15284071
  23. The results suggest that adenosine A 2B- but not beta2-adrenoceptor-mediated facilitation of noradrenaline release is enhanced by an ongoing activation of alpha2-adrenoceptors PMID:16040158
  24. A(2B) receptors may play role in regulating glomerular remodeling associated with glomerular mesangial cell proliferation. PMID:16103269
  25. adenosine A(2B) receptor in the posterior hypothalamus plays an inhibitory role in central cardiovascular regulation, and guanylate cyclase mediates the depressor and bradycardiac actions of adenosine A(2B) receptors. PMID:17363336
  26. These results suggest that purinergic inhibition of taurine efflux from pituicytes operates through A2b receptors coupled to intracellular cAMP increase. PMID:17391106
  27. proliferation-inhibiting A(2B)AR is itself an inducible receptor regulated by B-Myb. PMID:17979185
  28. Activation of adenosine A2b receptor results in protein kinase C-alpha-dependent removal of UNC5A from the cell surface. PMID:17995930
  29. Furthermore, we showed that A(2B)AR activation was necessary to promote a higher expression of VEGF in kidney glomeruli upon exposure to high d-glucose concentration. PMID:18060864
  30. A(2B) and D(2) receptors interact to modulate the release of catecholamine from rat carotid body. PMID:19536477

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products