MQLETQDALYVALELVIAALAVAGNVLVCAAVGASSALQTPTNYFLVSLATADVAVGLFA IPFAITISLGFCTDFHSCLFLACFVLVLTQSSIFSLLAVAVDRYLAIRVPLRYKGLVTGT RARGIIAVLWVLAFGIGLTPFLGWNSKDRATSNCTEPGDGITNKSCCPVKCLFENVVPMS YMVYFNFFGCVLPPLLIMMVIYIKIFMVACKQLQHMELMEHSRTTLQREIHAAKSLAMIV GIFALCWLPVHAINCITLFHPALAKDKPKWVMNVAILLSHANSVVNPIVYAYRNRDFRYS FHRIISRYVLCQTDTKGGSGQAGGQSTFSLSL
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Receptor for adenosine. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.
Gene References into Functions
these results suggested that activation of A2b receptor could be a novel therapeutic approach to high glucose-induced cardiomyocyte injury.PMID:29626279
Increased A2BAR and adenosine following unilateral lung ischemia as well as more ronchiolitis obliterans organizing pneumonia in A2BAR mutant rats implicate a protective role for A2BAR signaling in countering ischemic lung injuryPMID:28266889
renal fibroblasts express a functional AR1 receptor that inhibits cyclic AMP (cAMP) upon stimulation, leading to a functional AR2B receptor that increases cAMP upon stimulation.PMID:27466291
Our data indicate varying roles for A(2B)AR signaling in regulating blood pressure in SS ratsPMID:26385692
A2B receptors are downregulated during aging, leading to a reduced adenosine-mediated detrusor relaxation.PMID:25728851
The findings suggest that adenosine plays a role in signaling transmission via A2bR between taste cells in rats.PMID:24327108
that stimulation of A2B receptors protects against trauma and hemorrhagic shock -induced lung and muscle injury.PMID:23584760
Nitric oxide synthase/K+ channel cascade triggers the adenosine A(2B) receptor-sensitive renal vasodilation in female ratsPMID:23396225
The role of the A2B adenosine receptor (AR) in prostate cell death and growth was studiedPMID:23315335
Paracrine Ado A2b receptor signaling contributes to stimulus-evoked catecholamine secretion in hypoxic carotid body chemoreceptors.PMID:23885058
Hypoxia induced serotonin synthesis and secretion is amplified by ADORA2B signaling via MAPK/CREB and TPH-1 activation.PMID:23638125
We determined that the adenosine A(2B) receptor (A(2B)AR) mediates VEGF overproduction in ex vivo glomeruli exposed to high glucose concentration, requiring PKCalpha and Erk1/2 activation.PMID:23069939
2',3'-cAMP inhibits proliferation of vascular smooth muscle cells from the aorta and coronary arteries. This effect is due in part to metabolism of 2',3'-cAMP to adenosine, with engagement of the A2B receptor.PMID:21622827
the present study demonstrates that activation of A(2B)AR is strongly cardioprotective in rat heart and suppresses transition pores in isolated cardiomyocytesPMID:21246204
Endogenously produced luminal surface adenosine increases HCO3- secretion in an intact intestinal epithelium in vivo through the activation of A2B receptors.PMID:20805305
The A(2B)AR may contribute to the later stages of ischemic preconditioning dependent on the induction of stress-responsive genes.PMID:20797398
A(2A) and A(2B) receptors are functionally expressed in juxtamedullary afferent arterioles. The powerful vasodilating action of adenosine predominantly involves A(2B) receptor activation, which counteracts A(1) receptor-mediated vasoconstriction.PMID:20462966
A(2B) receptors may play a critical role in regulating vascular remodelingPMID:11882603
1,8-disubstituted xanthine derivatives: synthesis of potent A2B-selective adenosine receptor antagonistsPMID:11906291
Changes in expression of adenosine type-2B (A2B)receptors and a related intracellular second messenger were noted during chronic brain inflammation and following treatment with the NSAID drug flurbiprofen and its nitric oxide-donating derivative, HCT1026PMID:12807441
The results show that adenylyl cyclase activation by adenosine and phosphorylation of CREB, but not ERK1/2 or p38, is mainly mediated via the adenosine A(2B) receptor.PMID:12849998
A2bR are critically involved in adenosine-mediated inhibition of cardiac fibroblast functions.PMID:15284071
The results suggest that adenosine A 2B- but not beta2-adrenoceptor-mediated facilitation of noradrenaline release is enhanced by an ongoing activation of alpha2-adrenoceptorsPMID:16040158
A(2B) receptors may play role in regulating glomerular remodeling associated with glomerular mesangial cell proliferation.PMID:16103269
adenosine A(2B) receptor in the posterior hypothalamus plays an inhibitory role in central cardiovascular regulation, and guanylate cyclase mediates the depressor and bradycardiac actions of adenosine A(2B) receptors.PMID:17363336
These results suggest that purinergic inhibition of taurine efflux from pituicytes operates through A2b receptors coupled to intracellular cAMP increase.PMID:17391106
proliferation-inhibiting A(2B)AR is itself an inducible receptor regulated by B-Myb.PMID:17979185
Activation of adenosine A2b receptor results in protein kinase C-alpha-dependent removal of UNC5A from the cell surface.PMID:17995930
Furthermore, we showed that A(2B)AR activation was necessary to promote a higher expression of VEGF in kidney glomeruli upon exposure to high d-glucose concentration.PMID:18060864
A(2B) and D(2) receptors interact to modulate the release of catecholamine from rat carotid body.PMID:19536477