Recombinant Rat Adenosine receptor A2a (Adora2a)

Code: CSB-CF001376RA
Size:
20μg
20μg100μg
US$5562
Quantity:
Express system: in vitro E.coli expression system
Species: Rattus norvegicus (Rat)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
Adora2a
Uniprot NO.
Species
Rattus norvegicus (Rat)
Source
in vitro E.coli expression system
Expression Region
1-410
Target Protein Sequence
MGSSVYITVELAIAVLAILGNVLVCWAVWINSNLQNVTNFFVVSLAAADIAVGVLAIPFA ITISTGFCAACHGCLFFACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGVRAKG IIAICWVLSFAIGLTPMLGWNNCSQKDGNSTKTCGEGRVTCLFEDVVPMNYMVYYNFFAF VLLPLLLMLAIYLRIFLAARRQLKQMESQPLPGERTRSTLQKEVHAAKSLAIIVGLFALC WLPLHIINCFTFFCSTCRHAPPWLMYLAIILSHSNSVVNPFIYAYRIREFRQTFRKIIRT HVLRRQEPFQAGGSSAWALAAHSTEGEQVSLRLNGHPLGVWANGSATHSGRRPNGYTLGL GGGGSAQGSPRDVELPTQERQEGQEHPGLRGHLVQARVGASSWSSEFAPS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Receptor for adenosine. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.
Gene References into Functions
  1. These findings demonstrate that inosine acts via an A2B receptor-mediated pathway that impinges on specific potassium channel effectors. PMID:28294142
  2. the inhibition of SDF1CXC4 signaling by the activation of A2A receptor and subsequent increase in the level of cAMP may be a potential method to ameliorate pulmonary arterial hypertension. PMID:29693117
  3. The activation of Gs protein-coupled receptors (GsPCRs) and the GsPCRs-independent activation of Gs proteins and adenylyl cyclase by cholera toxin induce stimulation of cell surface adenosine receptors (A2A or A2B adenosine receptors). PMID:29587249
  4. these results provide a novel evidence for the use of adenosine A2AR antagonists as potential therapy for retinal ischemic diseases and demonstrate the effect of caffeine on the regulation of microglia-mediated neuroinflammation in the transient ischemic model PMID:28981089
  5. Study discloses a facilitatory action of adenosine A2A (A2AR) receptors upon axonal elongation and microtubule dynamics, providing new insights for A2ARs regulation of neuronal differentiation and axonal regeneration PMID:26068054
  6. Activation of adenosine A1 and A2A receptors and P2 purinoceptors potentially play a central role in the regulation of dopamine effects at the neuromuscular junction. PMID:27060487
  7. Our results suggest for the first time that septic hearts are more or less cardioprotected, the adenosine receptors AdorA2a and AdorA2b play predominant role for a reduced morphological and functional I/R injury in the septic heart. PMID:27757725
  8. Suggest role for A1 and A2A adenosine receptors in dipyridamole-mediated attenuation of ischemia perfusion induced acute kidney injury in rats. PMID:26728617
  9. additional evidence for the existence of an interaction between striatal Adenosine A2A receptors and cannabinoid CB1 receptors, playing a fundamental role in the regulation of striatal functions PMID:26526685
  10. ST1535 metabolites ST3932 and ST4206 are effective adenosine A2A receptor antagonists which maybe useful in treating Parkinson disease. PMID:25936513
  11. Chronic A2a AR stimulation prevents proteinuria and glomerular damage in experimental diabetes via an anti-inflammatory mechanism independent of oxidative stress and kidney hypoxia. PMID:25891445
  12. Adenosine, via activation of A(2A) receptors, may directly facilitate basolateral amygdala pyramidal cell output. PMID:25716780
  13. regulation of A1 and A2A receptors and loss of 5'-nucleotidase in the cerebral cortex suggest the existence of a neuroprotective mechanism against seizures PMID:25907806
  14. Solitary nucleus adenosine A2a receptors inhibits cardiopulmonary chemoreflex-evoked hemodynamic and regional sympathetic reflex responses via a GABA-ergic mechanism. PMID:25910812
  15. Extracellular cAMP, through its metabolite adenosine, reduced cardiomyocyte cAMP formation and hypertrophy by activating A1 adenosine receptors while delivering an antifibrotic signal to cardiac fibroblasts by A2 adenosine receptor activation. PMID:25401477
  16. Results suggest a mechanism of A2aR modulation of neurotransmitter release in cultured cells from medulla oblongata and suggest that protein kinase A mediates this modulation of neurotransmitter release via synapsin I phosphorylation PMID:24912137
  17. A(2A)R may have a great capacity to modulate patterned spontaneous activity during neural circuit refinement PMID:24777042
  18. A(1)-receptors decreased Ca(V)2 Ca(2+)-currents, while A(2A)-type receptors enhanced current through Ca(V)1 channels PMID:24014158
  19. Results provide the first evidence for a functional interaction between nicotinic and adenosine A2A R in striatal dopaminergic terminals, with likely therapeutic consequences for smoking, Parkinson's disease and other dopaminergic disorders. PMID:23638679
  20. are led to the conclusion that although ZM241385 had no influence on the progression of amygdala-kindled seizures, it had potent anti-convulsant profile and little adverse effects. PMID:22528231
  21. We also show that there is a complex cross-talk between IL-6, BDNF, the Adenosine A1 and A2a receptors that results in neuroprotection of retinal ganglion cells. PMID:24845382
  22. Data demonstrate that cultured OPCs express functional A2A receptors whose activation negatively modulate IK currents and inhibit cell differentiation. PMID:23770463
  23. The time course of Adora2a- and D2R-mediated transmission reflects underlying differences in the extent of spillover and pooling of inhibitory postsynaptic potentials (IPSPs). PMID:24872568
  24. Adenosine 2A receptor (A2AR) antagonist and small interference RNA knockdown of A2AR blocked cordycepin-induced apoptosis, p53 activation, and caspase-7 and PARP cleavage. PMID:24704558
  25. Dynamic changes in adenosine A1 receptors (A1Rs) and A2a receptors (A2aRs) were investigated in a kindling model of epilepsy. PMID:23783558
  26. blockade of A(2A) receptors was efficient in reverting the behavior, electrophysiological and morphological impairments induced by maternal separation (early life stress) PMID:22371048
  27. rat A2AR gene encodes two distinct proteins (A2AR and uORF5) in an A2AR-dependent manner. Our study reveals a new example of the complexity of the mammalian genome and provides novel insights into the function of A2AR. PMID:24293369
  28. G2L2 is a new effector that controls the action of A2AR by modulating its ability to regulate the Galphas-mediated cAMP contents. PMID:23994616
  29. Adenosine A2A receptors are involved in the regulation and protection of vascular reactivity following shock. Adenosine A2A receptor activation may have a beneficial effect on hemorrhagic shock by improving vascular reactivity and hemodynamic parameters. PMID:23587453
  30. Molecular chaperones (heat-shock proteins HSP90alpha and HSP70-1A) that interact with and retain partially folded A2A receptor prior to endoplasmic reticulum exit, were identified. PMID:23965991
  31. Antagonism of adenosine A2A receptors protects dentate gyrus from synaptic failure in severe oxygen and glucose deprivation. PMID:23261865
  32. Adenosine A(2A) receptors regulate the activity of sleep regulatory GABAergic neurons in the preoptic hypothalamus. PMID:23637137
  33. Adenosine A2a receptor induces glial cell derived neurotrophic factor (GDNF) expression at both the mRNA and protein levels. PMID:23032401
  34. The A(2a) adenosine receptor promotes glutamate release from synaptic-like vesicles and stimulates clcium efflux in rat hippocampus astrocytes. PMID:23154210
  35. Blockade of adenosine A(2A) receptors with ZM 241385 (10 nmol/L) attenuated TOF(fade) caused by all antinicotinic drugs tested, with the exception of the 'pure' presynaptic nicotinic antagonist hexamethonium. PMID:23013133
  36. Endogenous activation of adenosine A2 receptors (A2R) facilitates NMDAR-independent induction of persistent epileptiform discharges (PED) in both hippocampal poles, but suppresses NMDAR-dependent induction of PED in the ventral hippocampus. PMID:22401823
  37. Adenosine A2A receptors control the uptake of D-aspartate in primary cultured astrocytes as well as in an ex vivo preparation enriched in glial plasmalemmal vesicles (gliosomes) from adult rats. PMID:22298379
  38. Adenosine A1 receptor was not changed between adult and middle-aged groups, but treadmill running counteracted the age-related increase in adenosine A2A receptors. PMID:22064330
  39. A(2A) receptor activation is responsible for setting part of the GluR1 Ser-845 phosphorylation tonus and the availability of the AMPA receptor extrasynaptic pool for synaptic insertion and reinforcement of synaptic strength. PMID:21080412
  40. long-term L-glutamate treatment during gestation and lactation promotes a significant down-regulation of A1R in whole brain from both mother and neonates and a significant up-regulation of A2AR in neonates exposed to l-glutamate during lactation. PMID:21983553
  41. These data indicate that norepinephrine regulation of A2AR differs in developing and mature brain PMID:21742019
  42. Results show an enhanced adenosine A(2A) receptor-mediated modulation of LTP in aged rats, in accordance with the age-associated increased expression and density of A(A) R in glutamatergic terminals. PMID:21615561
  43. Since presynaptic A(2A)R function is not impaired, this receptor could probably be used as a target for the symptomatic treatment of Huntington disease. PMID:21867705
  44. A(2A)R activation can arrest glomerular nephritis and prevent progressive fibrosis in established pathological lesions. PMID:21508927
  45. The results indicate that the central NO/NO synthase system in the rostral ventrolateral medulla may modulate cardiovascular activity by activating the adenosine A(2A)R. PMID:21443689
  46. This study reveals that the activated A(2A)R in the rostral ventrolateral medulla underlies the depressor and bradycardiac responses in acute myocardial ischemic rats PMID:21703281
  47. The activation of the adenosine A(2A) receptor might enhance seizures associated to hyperthermia in the brain PMID:21144776
  48. Inhibition of adenosine A2A receptors prevents the lipopolysaccharide-induced depression of synaptic plasticity. PMID:21235574
  49. Activation of adenosine A2A receptors increases vascular endothelial growth factor and prevents testicular damage in experimental varicocele. PMID:20797711
  50. Adenosine A2A receptor activation attenuated tubuloglomerular responses by stimulation of endothelial nitric oxide synthase, presumably in the afferent arteriole. PMID:21106859

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Expressed in striatal neurons (at protein level).
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products