Home
Product
Protein
Transmembrane Proteins
Recombinant Rat Activator of apoptosis harakiri (Hrk)

Recombinant Rat Activator of apoptosis harakiri (Hrk)

Code: CSB-CF010741RA

Rate （N/A）
Review （0）

Size:

20μg100μg

US$3183

Quantity:

Express system: in vitro E.coli expression system

Species: Rattus norvegicus (Rat)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

Hrk

Uniprot NO.

P62817

Alternative Names

Hrk; Bid3; Dp5; Activator of apoptosis harakiri; BH3-interacting domain-containing protein 3; Neuronal death protein DP5

Species

Rattus norvegicus (Rat)

Source

in vitro E.coli expression system

Expression Region

1-92

Target Protein Sequence

MCPCPRHRGRGPPAVCGCGDARPGLRWAAAQVTALRLQALGDELHRRAMRRRARPRDPLP ALLPALRARWPWLCAAAQVAALAAWLLGRRSA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Promotes apoptosis.

Gene References into Functions

BH3 peptide has a role in releasing cytochrome c in rat brain mitochondria PMID:12700636
dp5 is a target gene of c-Jun and plays a critical role in potassium deprivation-induced apoptosis in cerebellar granule neurons. PMID:17428807
Bcl-2 regulates an essential pool of mitochondrial GSH and this regulation may depend upon Bcl-2 directly interacting with GSH via the BH3 groove PMID:17690097
identification of a conserved ATF site in the dp5 promoter that binds c-Jun and ATF2, which is critical for dp5 promoter induction after NGF withdrawal. PMID:19304750
The inactivation of hrk protein protects -cells from IL-1beta+IFN-gamma and chemical Endoplasmic Reticulum stress-mediated cell death. PMID:19629134