Home
Product
Protein
Transmembrane Proteins
Recombinant Rat ATP-binding cassette sub-family G member 5 (Abcg5)

Recombinant Rat ATP-binding cassette sub-family G member 5 (Abcg5)

Code: CSB-CF859583RA

Rate （N/A）
Review （0）

Size:

20μg100μg

US$7373

Quantity:

Express system: in vitro E.coli expression system

Species: Rattus norvegicus (Rat)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

Abcg5

Uniprot NO.

Q99PE7

Alternative Names

Abcg5; ATP-binding cassette sub-family G member 5; Sterolin-1

Species

Rattus norvegicus (Rat)

Source

in vitro E.coli expression system

Expression Region

1-652

Target Protein Sequence

MSELPFLSPEGARGPHNNRGSQSSLEEGSVTGSEARHSLGVLNVSFSVSNRVGPWWNIKS CQQKWDRKILKDVSLYIESGQTMCILGSSGSGKTTLLDAISGRLRRTGTLEGEVFVNGCE LRRDQFQDCVSYLLQSDVFLSSLTVRETLRYTAMLALRSSSADFYDKKVEAVLTELSLSH VADQMIGNYNFGGISSGERRRVSIAAQLLQDPKVMMLDEPTTGLDCMTANHIVLLLVELA RRNRIVIVTIHQPRSELFHHFDKIAILTYGELVFCGTPEEMLGFFNNCGYPCPEHSNPFD FYMDLTSVDTQSREREIETYKRVQMLESAFRQSDICHKILENIERTRHLKTLPMVPFKTK NPPGMFCKLGVLLRRVTRNLMRNKQVVIMRLVQNLIMGLFLIFYLLRVQNNMLKGAVQDR VGLLYQLVGATPYTGMLNAVNLFPMLRAVSDQESQDGLYQKWQMLLAYVLHALPFSIVAT VIFSSVCYWTLGLYPEVARFGYFSAALLAPHLIGEFLTLVLLGMVQNPNIVNSIVALLSI SGLLIGSGFIRNIEEMPIPLKILGYFTFQKYCCEILVVNEFYGLNFTCGGSNTSVPNNPM CSMTQGIQFIEKTCPGATSRFTTNFLILYSFIPTLVILGMVVFKVRDYLISR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

ABCG5 and ABCG8 form an obligate heterodimer that mediates Mg(2+)- and ATP-dependent sterol transport across the cell membrane. Plays an essential role in the selective transport of dietary plant sterols and cholesterol in and out of the enterocytes and in the selective sterol excretion by the liver into bile. Required for normal sterol homeostasis. The heterodimer with ABCG8 has ATPase activity.

Gene References into Functions

Amino acid substitution in the sterol transport protein Abcg5 controls serum marinobufagenin levels in spontaneously hypertensive rats. PMID:28982675
In contrast, the marked reduction of hepatic Abcg5/8 observed is an effect of the high sugar content of the diets. PMID:25912874
A missense mutation in Abcg5 in hypertensive rats results in deposition of plant sterols in the body, but does not change their biliary secretion and lymphatic absorption. PMID:22484926
Data reveal marked utilization of an Abcg5/Abcg8-independent mechanism for basal biliary cholesterol secretion in rats during lactation, but a dependence on Abcg5/g8 for maximal biliary cholesterol secretion. PMID:20413720
Mutation of Abcg5 in stroke-prone spontaneously hypertensive rats, compared with Wistar rats, did not influence the ability for intestinal sitosterol absorption regardless of the dose. PMID:19966468
Intestinal mRNA expression of Abcg5 (-47%) and Abcg8 (-43%) as well as Abcg5 protein contents are reduced in insulin-deficient animals. PMID:14618236
the previously identified Gly583Cys change in Abcg5 in three hypertension-susceptible rats is responsible for the sitosterolemia, but may not be a major determinant of blood pressure in these rats. PMID:16026620
These observations suggest that a mutation in Abcg5 does not greatly influence intestinal absorption of plant sterols in SHRSP rats, at least in comparison with Wistar rats. PMID:19202267