Home
Product
Protein
Transmembrane Proteins
Recombinant Rabbit Gap junction alpha-1 protein (GJA1)

Recombinant Rabbit Gap junction alpha-1 protein (GJA1)

Code: CSB-CF754384RB

Rate （N/A）
Review （0）

Size:

20μg100μg

US$5880

Quantity:

Express system: in vitro E.coli expression system

Species: Oryctolagus cuniculus (Rabbit)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

GJA1

Uniprot NO.

Q6TYA7

Alternative Names

GJA1; Gap junction alpha-1 protein; Connexin-43; Cx43

Species

Oryctolagus cuniculus (Rabbit)

Source

in vitro E.coli expression system

Expression Region

1-382

Target Protein Sequence

MGDWSALGKLLDKVQAYSTAGGKVWLSVLFIFRILLLGTAVESAWGDEQSAFRCNTQQPGC ENVCYDKSFPISHVRFWVLQIIFVSVPTLLYLAHVFYVMRKEEKLNKKEEELKVAQTDGV NVEMHLKQIEIKKFKYGIEEHGKVKMRGGLLRTYIISILFKSVFEVAFLLIQWYIYGFSL SAVYTCKRDPCPHQVDCFLSRPTEKTIFIIFMLVVSLVSLALNIIELFYVFFKGVKDRVK GKSDPYHATTGPLSPSKDCGSPKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNY NKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNSKKLAAGHELQPLAIVDQ RPSSRASSRASSRPRPDDLEI
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Shelf Life

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Gap junction protein that acts as a regulator of bladder capacity. A gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell. May play a critical role in the physiology of hearing by participating in the recycling of potassium to the cochlear endolymph. Negative regulator of bladder functional capacity: acts by enhancing intercellular electrical and chemical transmission, thus sensitizing bladder muscles to cholinergic neural stimuli and causing them to contract. May play a role in cell growth inhibition through the regulation of NOV expression and localization. Plays an essential role in gap junction communication in the ventricles.

Gene References into Functions

These findings indicated that Cx43/miR-206 is involved in the pathogenesis of early stage steroid-induced avascular necrosis of the femoral head. PMID:27450649
Vascular remodeling post stent implantation varied according to the presence of balloon injury, cholesterol-enriched diet, or both. PMID:22330626
Gap junction enhancer AAP10 could attenuate the pro-arrhythmic effect of lysophosphatidic acid, probably by downregulating myocardial nonphosphorylated Cx43 expression. PMID:21624303
Ischemic postconditioning protected the heart from I/R injury by attenuating I/R induced decrease of mitochondria Cx43 expression. PMID:20654085
In addition to Cx43 dephosphorylation, downregulation of Cx43 plays an essential role in reduced cell coupling in the failing rabbit heart PMID:19880431