Recombinant Rabbit Calcitonin receptor (CALCR)

Code: CSB-CF004439RB

Rate （N/A）
Review （0）

Size:

20μg100μg

US$5877

Quantity:

Express system: in vitro E.coli expression system

Species: Oryctolagus cuniculus (Rabbit)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

CALCR

Uniprot NO.

P79222

Alternative Names

CALCR; Calcitonin receptor; CT-R

Species

Oryctolagus cuniculus (Rabbit)

Source

in vitro E.coli expression system

Expression Region

23-474

Target Protein Sequence

NPASSNDTHPTVEPEPFLYVIGRKKLMDAQYKCYDRMEQLPPYQGEGPYCNRTWDGWMCW DDTPAGVLGFQYCPDYFPDFDPTEKVTKYCDETGVWFKHPGNNQTWSNYTMCNAFTPEKL QNAYVLYYLAIVGHSLSIFTLVISLGIFKCFRSLGCQRVTLHKNMFLTYILNSMIIIIHL VEVVPNGELVRRDPVSCKVLHFFHQYMMSCNYFWMLCEGIYLHTLIVVAVFAKQQHLRWY YLLGWGFPLVPTTIHAITRAIYFNDNCWMSVETHLLYIIHGPVMAALVVNFFFLLNIVRV LVTKMRETLEAESHMYLKAVKATMILVPLLGIQFVVFPWRPSNKILGKIYDYLMHSLIHF QGFFVATIYCFCNNEVQTTVKRQWVQFKIQWNQRWGRRPAHRSVSRTAASAEEGGIPVYI YHQEPRNDPAHSLGEEGAEIIPLNIIEQESSA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

This is a receptor for calcitonin. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. The calcitonin receptor is thought to couple to the heterotrimeric guanosine triphosphate-binding protein that is sensitive to cholera toxin. Isoform 2 has altered ligand binding and abolished coupling to phospholipase C.

Subcellular Location

Cell membrane; Multi-pass membrane protein.

Protein Families

G-protein coupled receptor 2 family

Tissue Specificity

Isoform 1 and isoform 2 are expressed in a tissue-specific manner, with isoform 2 accounting for less than 15% of the total calcitonin receptor mRNA in osteoclasts, kidney, and brain, but comprising at least 50% of the transcripts in skeletal muscle and l

Database Links

UNIGENE: Ocu.2121

Promotions