Recombinant Rabbit CD166 antigen (ALCAM)

Code: CSB-CF001562RB

Rate （N/A）
Review （0）

Size:

20μg100μg

US$6393

Quantity:

Express system: in vitro E.coli expression system

Species: Oryctolagus cuniculus (Rabbit)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

ALCAM

Uniprot NO.

O46651

Alternative Names

ALCAM; CD166 antigen; Activated leukocyte cell adhesion molecule; SB-10 antigen; CD antigen CD166; Fragment

Species

Oryctolagus cuniculus (Rabbit)

Source

in vitro E.coli expression system

Expression Region

1-521

Target Protein Sequence

GSPVFIAFRSSTKKSVQYDDVPEYKDRLNLSENYTLSISNARISDEKRFVCMLVTEDDVF EAPTVVKVFKQPSKPEIVSKAPFLETEQLQKLGDCISRDSYPEGNITWYRNGKVLQPLEG AVVIIFKKQMDPVTQLYTMTSSLEYKTTKADIQTPFTCSITYYGPSGQKTVHSEQAVFDI YYPTEQVTIQVLPPKNAIKEGDNITLKCLGNGNPPPEEFFFYLPGQPEGIRSSNTYTLPN VRRNATGNYKCSLIDKKSLIASTAITVHYLDLSLNPXGELTKQIGDSLPVSCTISAIRNA TVVWMKDNIKLRSSPSFSSLQYQDAGNYVCETALQEVEGLKKRESLTLIVEVKPQIKMTK KTDPSGLSKTIICHVEGFPKPAIQWTITGSGSVINQTEESPYINGRYYSKIIISPEENVT LTCAAENQLERTVNSLNVSAISIPEHDEADEISDENREKVNDQAKLIVGIVVGLLLAALV AGVVYWLYMKKSKTASKHVNKDLGNMEENKKLEENNHKTEA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Cell adhesion molecule that mediates both heterotypic cell-cell contacts via its interaction with CD6, as well as homotypic cell-cell contacts. Promotes T-cell activation and proliferation via its interactions with CD6. Contributes to the formation and maturation of the immunological synapse via its interactions with CD6. Mediates homotypic interactions with cells that express ALCAM. Mediates attachment of dendritic cells onto endothelial cells via homotypic interaction. Inhibits endothelial cell migration and promotes endothelial tube formation via homotypic interactions. Required for normal organization of the lymph vessel network. Required for normal hematopoietic stem cell engraftment in the bone marrow. Plays a role in hematopoiesis; required for normal numbers of hematopoietic stem cells in bone marrow. Promotes in vitro osteoblast proliferation and differentiation. Promotes neurite extension, axon growth and axon guidance; axons grow preferentially on surfaces that contain ALCAM. Mediates outgrowth and pathfinding for retinal ganglion cell axons.

Subcellular Location

Cell membrane; Single-pass type I membrane protein. Cell projection, axon. Cell projection, dendrite.

Database Links

UNIGENE: Ocu.2195

STRING: 9986.ENSOCUP00000020319

Promotions