Home
Product
Protein
Transmembrane Proteins
Recombinant Rabbit C-X-C chemokine receptor type 2 (CXCR2)

Recombinant Rabbit C-X-C chemokine receptor type 2 (CXCR2)

Code: CSB-CF011673RB

Rate （N/A）
Review （0）

Size:

20μg100μg

US$5173

Quantity:

Express system: in vitro E.coli expression system

Species: Oryctolagus cuniculus (Rabbit)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

CXCR2

Uniprot NO.

P35344

Alternative Names

CXCR2; IL8RB; C-X-C chemokine receptor type 2; CXC-R2; CXCR-2; GRO/MGSA receptor; High affinity interleukin-8 receptor B; IL-8R B; CD antigen CD182

Species

Oryctolagus cuniculus (Rabbit)

Source

in vitro E.coli expression system

Expression Region

1-358

Target Protein Sequence

MQEFTWENYSYEDFFGDFSNYSYSTDLPPTLLDSAPCRSESLETNSYVVLITYILVFLLS LLGNSLVMLVILYSRSTCSVTDVYLLNLAIADLLFATTLPIWAASKVHGWTFGTPLCKVV SLVKEVNFYSGILLLACISVDRYLAIVHATRTMIQKRHLVKFICLSMWGVSLILSLPILL FRNAIFPPNSSPVCYEDMGNSTAKWRMVLRILPQTFGFILPLLVMLFCYVFTLRTLFQAH MGQKHRAMRVIFAVVLIFLLCWLPYNLVLLTDTLMRTHVIQETCERRNDIDRALDATEIL GFLHSCLNPIIYAFIGQKFRYGLLKILAAHGLISKEFLAKESRPSFVASSSGNTSTTL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Receptor for interleukin-8 which is a powerful neutrophil chemotactic factor. Binding of IL-8 to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. Binds to IL-8 with high affinity. Also binds with high affinity to CXCL3, GRO/MGSA and NAP-2.

Subcellular Location

Cell membrane; Multi-pass membrane protein.

Protein Families

G-protein coupled receptor 1 family

Tissue Specificity

Expressed preferentially in neutrophils.

Database Links

UNIGENE: Ocu.1988

KEGG: ocu:100328627

Promotions