Home
Product
Protein
Transmembrane Proteins
Recombinant Protobothrops elegans NADH-ubiquinone oxidoreductase chain 4 (MT-ND4)

Recombinant Protobothrops elegans NADH-ubiquinone oxidoreductase chain 4 (MT-ND4)

Code: CSB-CF015079PSR

Rate （N/A）
Review （0）

Size:

20μg100μg

US$4223

Quantity:

Express system: in vitro E.coli expression system

Species: Protobothrops elegans (Elegant pitviper) (Trimeresurus elegans)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

MT-ND4

Uniprot NO.

P92793

Alternative Names

MT-ND4; MTND4; NADH4; ND4; NADH-ubiquinone oxidoreductase chain 4; NADH dehydrogenase subunit 4; Fragment

Species

Protobothrops elegans (Elegant pitviper) (Trimeresurus elegans)

Source

in vitro E.coli expression system

Expression Region

1-231

Target Protein Sequence

PIAGSMVLAAILLKLGGYGIIRMMQVLPTTKTDMFLPFIVLALWGAILANLTCLQQTDLK SLIAYSSISHMGLVVAAIIIQTPWSLSGAMALMIAHGFTSSALFCLANTTYERTHTRILI LTRGFHNILPMTTTWWLLTNLMNIATPPTLNFTSELLIMSSLFNWCPTTIILLGLSMLIT ASYSLHMFLSTQMGPTLLDNQTEPTHSREHLLMALHIIPLVMISMKPELII
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Subcellular Location

Mitochondrion membrane; Multi-pass membrane protein.

Protein Families

Complex I subunit 4 family

Promotions