Home
Product
Protein
Transmembrane Proteins
Recombinant Porcine reproductive and respiratory syndrome virus Glycoprotein 5 (GP5)

Recombinant Porcine reproductive and respiratory syndrome virus Glycoprotein 5 (GP5)

Code: CSB-CF367569PYZ

Rate （N/A）
Review （0）

Size:

20μg100μg

US$3759

Quantity:

Express system: in vitro E.coli expression system

Species: Porcine reproductive and respiratory syndrome virus (isolate Pig/United States/SD 01-08/2001) (PRRSV)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

GP5

Uniprot NO.

A0MD34

Alternative Names

GP5; 5; Glycoprotein 5; Protein GP5; G(L

Species

Porcine reproductive and respiratory syndrome virus (isolate Pig/United States/SD 01-08/2001) (PRRSV)

Source

in vitro E.coli expression system

Expression Region

33-201

Target Protein Sequence

DGNGNNSTYQYIYNLTICELNGTNWLSGHFEWAVETFVLYPVVTHILSLGFLTTSHFFDA LGLGAVSTAGFVGGRYVLSSVYGACAFAAFVCFVIRAAKNCMACRYARTRFTNFIVDDRG GVHRWKSPIVVEKLGKAEIGGNLVTIKHVVLEGVKAQPLTRTSAEQWEA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Major envelope protein present in abundant amounts in the virion envelope. Mediates virion sialic acid-dependent attachment the sialoadhesin receptor SIGLEC1. This attachment induces virion internalization into alveolar macrophages predominantly through clathrin-dependent endocytosis.

Subcellular Location

Virion membrane; Multi-pass membrane protein.

Protein Families

Arteriviridae GP5 protein family

Promotions