Home
Product
Protein
Transmembrane Proteins
Recombinant Pig Type-1 angiotensin II receptor (AGTR1)

Recombinant Pig Type-1 angiotensin II receptor (AGTR1)

Code: CSB-CF001465PI

Rate （N/A）
Review （0）

Size:

20μg100μg

US$5181

Quantity:

Express system: in vitro E.coli expression system

Species: Sus scrofa (Pig)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

AGTR1

Uniprot NO.

P30555

Alternative Names

AGTR1; Type-1 angiotensin II receptor; Angiotensin II type-1 receptor; AT1

Species

Sus scrofa (Pig)

Source

in vitro E.coli expression system

Expression Region

1-359

Target Protein Sequence

MILNSSTEDSIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLVVIVIYFYMKLK TVASVFLLNLALADLCFLLTLPLWAVYTAMEYRWPFGNYLCKIASASVSFNLYASVFLLT CLSIDRYLAIVHPMKSRLRRTMLVAKVTCIIIWLLAGLASLPTIIHRNVFFIENTNITVC AFHYESQNSTLPVGLGLTKNILGFLFPFLIILTSYTLIWKALKKAYEIQKNKPRNDDIFK IIMAIVLFFFFSWVPHQIFTFLDVLIQLGIIHDCKIADIVDTAMPITICLAYFNNCLNPL FYGFLGKKFKKYFLQLLKYIPPKAKSHSSLSTKMSTLSYRPSENGSSSTKKSAPCTEVE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Receptor for angiotensin II. Mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system.

Gene References into Functions

Luminal ANG II is internalized as a complex with AT1R/AT2R heterodimers to target endoplasmic reticulum in LLC-PK1 cells, where it might trigger intracellular calcium responses. PMID:28468964
These studies provide insight into kidney biology as the first in vivo/in vitro experimental evidence about AT(1)R regulation in response to reduced perfusion of the kidney. PMID:18172054
AT1 and AT2 receptors heterodimerize and are involved in the angiotensin II effect on SERCA in proximal kidney tubules. PMID:22218590
A critical role for lipid raft microdomains in AGTR1-mediated signal transduction in neonatal glomerular mesengial cells. PMID:24662198
AT1 receptors are positively coupled to the proliferative response of vascular smooth muscle cells to angiotensin II. PMID:21622819