Home
Product
Protein
Transmembrane Proteins
Recombinant Pig Solute carrier family 2, facilitated glucose transporter member 4 (SLC2A4)

Recombinant Pig Solute carrier family 2, facilitated glucose transporter member 4 (SLC2A4)

Code: CSB-CF894553PI

Rate （N/A）
Review （0）

Size:

20μg100μg

US$3796

Quantity:

Express system: in vitro E.coli expression system

Species: Sus scrofa (Pig)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

SLC2A4

Uniprot NO.

Q9XT10

Species

Sus scrofa (Pig)

Source

in vitro E.coli expression system

Expression Region

1-174

Target Protein Sequence

QQIGSEDGEPPQQRVTGTLVLAVFSAVLGSLQFGYNIGVINAPQKVIEQSYNETWLGRQG PNGPGSIPPGTLTTLWALSVAIFSVGGMFSSFLLGIISQWLGRKKAMLFNNTLAVLAGAL MGLAKAAASYEMLILGRFLIGAYSGLASGLVPMYVGEIAPTHLRGALGTLNQLA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Insulin-regulated facilitative glucose transporter, which plays a key role in removal of glucose from circulation. Response to insulin is regulated by its intracellular localization: in the absence of insulin, it is efficiently retained intracellularly within storage compartments in muscle and fat cells. Upon insulin stimulation, translocates from these compartments to the cell surface where it transports glucose from the extracellular milieu into the cell.

Subcellular Location

Cell membrane; Multi-pass membrane protein. Endomembrane system; Multi-pass membrane protein. Cytoplasm, perinuclear region.

Protein Families

Major facilitator superfamily, Sugar transporter (TC 2.A.1.1) family, Glucose transporter subfamily

Database Links

UNIGENE: Ssc.15984

STRING: 9823.ENSSSCP00000022419

Promotions