MTLHNNNTTSPLFPNISSSWIHGPSDAGLPPGTVTHFGSYNISQAAGNFSSPNGTTSDPL GGHTIWQVVFIAFLTGILALVTIIGNILVIVAFKVNKQLKTVNNYFLLSLACADLIIGVI SMNLFTTYIIMNRWALGNLACDLWLSIDYVASNASVMNLLVISFDRYFSITRPLTYRAKR TTKRAGVMIGLAWVISFILWAPAILFWQYFVGKRTVPPGECFIQFLSEPTITFGTAIAAF YMPVTIMTILYWRIYKETEKRTKELAGLQASGTEAEAENFVHPTGSSRSCSSYELQQQSL KRSARRKYGRCHFWFTTKSWKPSAEQMDQDHSSSDSWNNNDAAASLENSASSDEEDIGSE TRAIYSIVLKLPGHSTILNSTKLPSSDNLQVPEEELGTVDLERKASKLQAQKSMDDGGSF QKSFSKLPIQLESAVDTAKASDVNSSVGKTTATLPLSFKEATLAKRFALKTRSQITKRKR MSLIKEKKAAQTLSAILLAFIITWTPYNIMVLVNTFCDSCIPKTYWNLGYWLCYINSTVN PVCYALCNKTFRTTFKMLLLCQCDKRKRRKQQYQQRQSVIFHKRVPEQAL
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
The muscarinic acetylcholine receptor mediates various cellular responses, including inhibition of adenylate cyclase, breakdown of phosphoinositides and modulation of potassium channels through the action of G proteins. Primary transducing effect is Pi turnover.
Gene References into Functions
Data suggest that both M(2) and M(3) muscarinic receptors mediate the contraction in both pig clasp and sling fibers similar to human clasp and sling fibers.PMID:20133950
Expression and function of M2 and M3 receptors are similar in the detrusor of juvenile and mature pigs.PMID:18157728
M2 and M3 receptors are upregulated in a time-dependent and pressure-dependent fashion after as little as a 24 h exposure to increased hydrostatic pressure in bladderPMID:18563417