Recombinant Pig Integrin beta-2 (ITGB2)

CSB-CF011884PI

Rate （N/A）
Review （0）

Size:

20μg100μg

US$8084

Quantity:

Express system: in vitro E.coli expression system

Species: Sus scrofa (Pig)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Orders can only be placed from within the U.S.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

ITGB2

Uniprot NO.

P53714

Species

Sus scrofa (Pig)

Source

in vitro E.coli expression system

Expression Region

23-769

Target Protein Sequence

QECAKYKVSTCRDCIESGPGCAWCQKLNFSGQGEPDSVRCDTREQLLAKGCVADDIVDPRSLAETQEDQAGGQKQLSPQKVTLYLRPGQAATFNVTFRRAKGYPIDLYYLMDLSYSMLDDLINVKKLGGDLLRALNEITESGRIGFGSFVDKTVLPFVNTHPEKLRNPCPNKEKECQAPFAFRHVLKLTDNSNQFQTEVGKQLISGNLDAPEGGLDAMMQVAACPEEIGWRNVTRLLVFATDDGFHFAGDGKLGAILTPNDGRCHLEDNLYKSSNEFDYPSVGQLAHKLAESNIQPIFAVTKKMVKTYEKLTDIIPKSAVGELSEDSSNVLELIKNAYNKLSSRVFLDHNALPDTLKVTYDSFCSNGVSQVNQPRGDCDGVQINVPITFQVKVTASECIQEQSFVIRALGFTDTVTVRVLPQCECRCGDSSKERTLCGNKGSMECGVCRCDAGYIGKHCECQTQGRSSQELEGSCRKDNSSIICSGLGDCICGQCVCHTSDVPNKKIYGQFCECDNMNCERFDGQVCGGEKRGLCFCSTCRCQEGFEGSACQCLKSTQGCLNLQGVECSGRGRCRCNVCQCDFGYQPPLCTDCPSCQVPCARYAKCAECLKFDTGPFAKNCSAECGTTKLLPSRMSGRKCNERDSEGCWMTYFLVQRDGRDNYDLHVEETRECVKGPNIAAIVGGTVGGVVLVGIFLLVIWKVLTHLSDLREYKRFEKEKLKSQWNNDNPLFKSATTTVMNPKFAER

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 10xHis-tagged

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Description

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function

Integrin ITGAL/ITGB2 is a receptor for ICAM1, ICAM2, ICAM3 and ICAM4. Integrin ITGAL/ITGB2 is also a receptor for the secreted form of ubiquitin-like protein ISG15; the interaction is mediated by ITGAL. Integrins ITGAM/ITGB2 and ITGAX/ITGB2 are receptors for the iC3b fragment of the third complement component and for fibrinogen. Integrin ITGAX/ITGB2 recognizes the sequence G-P-R in fibrinogen alpha-chain. Integrin ITGAM/ITGB2 recognizes P1 and P2 peptides of fibrinogen gamma chain. Integrin ITGAM/ITGB2 is also a receptor for factor X. Integrin ITGAD/ITGB2 is a receptor for ICAM3 and VCAM1. Contributes to natural killer cell cytotoxicity. Involved in leukocyte adhesion and transmigration of leukocytes including T-cells and neutrophils. Triggers neutrophil transmigration during lung injury through PTK2B/PYK2-mediated activation. Integrin alpha-L/beta-2 in association with ICAM3, contributes to apoptotic neutrophil phagocytosis by macrophages.

Gene References into Functions

CR3 plays a cardinal role in beta-glucan signalling in porcine neutrophils, while macrophages use a more diverse receptor array to detect and respond towards beta-glucans. PMID:25453580
The expression of zona pellucida glycoprotein 3 and integrin beta-2 in oocytes after brilliant cresyl blue staining is reported. PMID:21295838
early CD18 downregulation is profitable for the host in a situation with an intense LPS stimulus PMID:18782273
It is concluded that porcine CD18 is necessary to mediate A. pleuropneumoniae ApxIIIA toxin-induced leukolysis. PMID:19356397