Recombinant Pig Follicle-stimulating hormone receptor (FSHR)

Code: CSB-CF009021PI
Size:
20μg
20μg100μg
US$7568
Quantity:
Express system: in vitro E.coli expression system
Species: Sus scrofa (Pig)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
FSHR
Uniprot NO.
Species
Sus scrofa (Pig)
Source
in vitro E.coli expression system
Expression Region
18-695
Target Protein Sequence
CHHRICHCSNGVFLCQESKVTEIPPDLPRNAVELRFVLTKLRVIPKGAFSGFGDLEKIEI SQNDVLEVIEANVFSNLPKLHEIRIEKANNLLYIDPDAFQNLPNLRYLLISNTGVKHLPA VHKIQSLQKVLLDIQDNINIHTVERNSFVGLSFESMILWLSKNGIREIHNCAFNGTQLDE LNLSDNDNLEELPNDVFQGASGPVILDISRTRIHSLPSYGLENLKKLRAKSTYNLKKLPS LEKFVTLMEASLTYPSHCCAFANWRRQISDLHPICNKSILRQEVDVMTQARGQRVSLAED GESSLAKEFDTMYSEFDYDLCNEVVDVICSPEPDTFNPCEDIMGHDILRVLIWFISILAI TGNIIVLVILITSQYKLTVPRFLMCNLAFADLCIGIYLLLIASVDIHTKTQYHNYAIDWQ TGAGCDAAGFFTVFASELSVYTLTAITLERWHTITHAMQLQCKVQLRHAASIMLVGWIFA FTVALFPIFGISSYMKVSICLPMDIDSPLSQLYVVSLLVLNVLAFVVICGCYTHIYLTVR NPNIMSSSSDTKIAKRMAMLIFTDFLCMAPISFFAISASLKVPLITVSKSKILLVLFYPI NSCANPFLYAIFTKNFRRDVFILLSKFGCYEMQAQTYRTENLSTAHNIHPRNGHCPPAPR ITNSSSYTLIPLSRLAQN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
G protein-coupled receptor for follitropin, the follicle-stimulating hormone. Through cAMP production activates the downstream PI3K-AKT and ERK1/ERK2 signaling pathways.
Gene References into Functions
  1. Activated TGF-beta signaling rescued miR-143-reduced FSHR and intracellular signaling molecules, and miR-143-induced porcine granulosa cell apoptosis. PMID:27882941
  2. The results showed that polymorphisms in exon 10 of the FSHR gene had a significant effect on litter size traits of Wannan Black and Berkshire pigs. These results can be applied for marker-assisted selection in the 2 swine breeds PMID:26345751
  3. These results showed that an increased FSHR gene expression level was accompanied with an increase in histone H3K9 acetylation levels, suggesting that histone H3K9 acetylation could regulate the expression of the porcine FSHR gene. PMID:25599592
  4. This study tested whether prenatal and neonatal exposure to antiandrogen flutamide affected ovarian 17beta-estradiol synthesis and the associated gene expression in large antral follicles of adult pigs. PMID:23043943
  5. 248 F(2) animals from a Duroc and Meishan cross were genotyped for three FSHR SNPs at positions 74, 532 and 1166, and these were correlated with the phenotypes of litter size and corpus luteum number PMID:21951899
  6. findings suggest the FSH receptor may be involved in the early follicle formation in pigs, which begins during prenatal life. PMID:20642491

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family, FSH/LSH/TSH subfamily
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products