CHHRICHCSNGVFLCQESKVTEIPPDLPRNAVELRFVLTKLRVIPKGAFSGFGDLEKIEI SQNDVLEVIEANVFSNLPKLHEIRIEKANNLLYIDPDAFQNLPNLRYLLISNTGVKHLPA VHKIQSLQKVLLDIQDNINIHTVERNSFVGLSFESMILWLSKNGIREIHNCAFNGTQLDE LNLSDNDNLEELPNDVFQGASGPVILDISRTRIHSLPSYGLENLKKLRAKSTYNLKKLPS LEKFVTLMEASLTYPSHCCAFANWRRQISDLHPICNKSILRQEVDVMTQARGQRVSLAED GESSLAKEFDTMYSEFDYDLCNEVVDVICSPEPDTFNPCEDIMGHDILRVLIWFISILAI TGNIIVLVILITSQYKLTVPRFLMCNLAFADLCIGIYLLLIASVDIHTKTQYHNYAIDWQ TGAGCDAAGFFTVFASELSVYTLTAITLERWHTITHAMQLQCKVQLRHAASIMLVGWIFA FTVALFPIFGISSYMKVSICLPMDIDSPLSQLYVVSLLVLNVLAFVVICGCYTHIYLTVR NPNIMSSSSDTKIAKRMAMLIFTDFLCMAPISFFAISASLKVPLITVSKSKILLVLFYPI NSCANPFLYAIFTKNFRRDVFILLSKFGCYEMQAQTYRTENLSTAHNIHPRNGHCPPAPR ITNSSSYTLIPLSRLAQN
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
G protein-coupled receptor for follitropin, the follicle-stimulating hormone. Through cAMP production activates the downstream PI3K-AKT and ERK1/ERK2 signaling pathways.
Gene References into Functions
Activated TGF-beta signaling rescued miR-143-reduced FSHR and intracellular signaling molecules, and miR-143-induced porcine granulosa cell apoptosis.PMID:27882941
The results showed that polymorphisms in exon 10 of the FSHR gene had a significant effect on litter size traits of Wannan Black and Berkshire pigs. These results can be applied for marker-assisted selection in the 2 swine breedsPMID:26345751
These results showed that an increased FSHR gene expression level was accompanied with an increase in histone H3K9 acetylation levels, suggesting that histone H3K9 acetylation could regulate the expression of the porcine FSHR gene.PMID:25599592
This study tested whether prenatal and neonatal exposure to antiandrogen flutamide affected ovarian 17beta-estradiol synthesis and the associated gene expression in large antral follicles of adult pigs.PMID:23043943
248 F(2) animals from a Duroc and Meishan cross were genotyped for three FSHR SNPs at positions 74, 532 and 1166, and these were correlated with the phenotypes of litter size and corpus luteum numberPMID:21951899
findings suggest the FSH receptor may be involved in the early follicle formation in pigs, which begins during prenatal life.PMID:20642491