Recombinant Pig Endothelin-1 receptor (EDNRA)

Code: CSB-CF644898PI

Rate （N/A）
Review （0）

Size:

20μg100μg

US$5540

Quantity:

Express system: in vitro E.coli expression system

Species: Sus scrofa (Pig)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

EDNRA

Uniprot NO.

Q29010

Alternative Names

EDNRA; Endothelin-1 receptor; Endothelin receptor type A; ET-A; ET-AR

Species

Sus scrofa (Pig)

Source

in vitro E.coli expression system

Expression Region

21-427

Target Protein Sequence

DNPESHSTNLSTHVDDFTTFRGTEFSLVVTTHRPTNLALPSNGSMHNYCPQQTKITSAFK YINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFK LLAGRWPFENHDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPL VTAIEIVSIWILSFILAIPEAIGFVMVPFEYKGEEHKTCMLNATSKFMEFYQDVKDWWLF GFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQRREVAKTVFCLVVIFALCWF PLHLSRILKKTVYDEMDKNRCELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCF QSCLCCCCYQSKSLMTSVPMNGTSIQWKNHEQNNHNTERSSHKDSIN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Receptor for endothelin-1. Mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. The rank order of binding affinities for ET-A is: ET1 > ET2 >> ET3.

Gene References into Functions

sub-vasomotor concentration of ET-1 leads to vascular dysfunction by impairing endothelium-dependent NO-mediated dilation via p38 kinase-mediated production of superoxide from NADPH oxidase following ETA receptor activation PMID:26211713
PDE5 inhibition and increase in cGMP produce pulmonary vasodilation that is mediated in part through inhibition of the ET pathway, thereby precluding an additional vasodilator effect of ETA/ETB receptor blockade in the presence of PDE5 inhibition. PMID:24414253
Blocking ET(A) and ET(B) receptors partially protects sinusoidal circulation and tissue oxygenation against stress induced by high intra-abdominal pressure (IAP). PMID:22908974
Dual endothelin receptor blockade with tezosentan attenuates hypoxia-induced pulmonary vasoconstriction in porcine model. PMID:21726419
These results suggest that endothelin released during endotoxemia acts via endothelin A receptors to impair renal medullary blood flow causing ischemia. PMID:21760895
Anti-endothelin receptor A therapy accelerated the reversal of flow-induced pulmonary arterial disease after flow correction. PMID:20723731
study suggests a possible role for endothelin-1(resulting from the actions of endothelin-converting enzyme-1) acting via endothelin receptor A in the control of luteolytic sensitivity in the pig PMID:19783117
Blockade improves renal hemodynamic and function in hypercholesterolemia(HC), and decreases oxidative stress, and renal vascular and tubulointerstitial inflammation and fibrosis. Role for endothelin system in renal injury in HC and atherosclerosis. PMID:12911546
Results suggest that endothelin A and B receptor protein and mRNA expression is developmentally regulated in the postnatal swine mesenteric artery. PMID:15240868
Endothelin-A receptor antagonist alters the expression of vasoactive genes and proinflammatory cytokines during hepatic ischemic/reperfusion. PMID:15838252
Report that inhalation of the endothelin-A receptor antagonist LU-135252 at various doses in experimental acute lung injury improved gas exchange and hemodynamics. PMID:15838267
ET(A) blockade had no effect on pulmonary vascular resistance at rest or during exercise. PMID:16709643
PKC and MAPK seem to be involved in the regulation of endothelin type A and type B receptor expression in porcine coronary arteries PMID:18031734