Recombinant Pig Cytochrome b-245 heavy chain (CYBB)

Code: CSB-CF006325PI
Size:
20μg
20μg100μg
US$6116
Quantity:
Express system: in vitro E.coli expression system
Species: Sus scrofa (Pig)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
CYBB
Uniprot NO.
Alternative Names
CYBB; Cytochrome b-245 heavy chain; CGD91-phox; Cytochrome b(558 subunit beta; Cytochrome b558 subunit beta; Heme-binding membrane glycoprotein gp91phox; Neutrophil cytochrome b 91 kDa polypeptide; gp91-1; gp91-phox; p22 phagocyte B-cytochrome; Fragment
Species
Sus scrofa (Pig)
Source
in vitro E.coli expression system
Expression Region
1-484
Target Protein Sequence
STRVRRQLDRNLTFHKMVAWMIALHATIHTIAHLFNVEWCVNARVNNSDPYSIALSDIGD KPNETYLNFVRQRIKNPEGGLYVAVTRLAGITGVVITLCLILIITSSTKTIRRSYFEVFW YTHHLFVIFFIGLAIHGAERIVRRQTPKSLLVHDPKACAQNISQWGKIKDCPIPEFAGNP PMTWKWIVGPMFLYLCERLVRFWRSQQKVVITKVVTHPFKTIELQMKKKGFRMEVGQYIF VKRPAVSKLEWHPFTLTSAPEEDFFSIHIRIVGDWTEGLFKACGCDKQEFQDAWKLPKIA VDGPFGTASEDVFSYQVVMLVGAGIGVTPFASILKSVWYKYCNNATNLRLKKIYFYWLCR DTHAFEWFADLLQLLETQMQERNNAGFLSYNIYLTGWDESQANHFAVHHDEEKDVITGLK QKTLYGRPNWDNEFKTIASQHPTTRIGVFLCGPEALAETLNKQCISNSDSSPRGVHFIFN KENF
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Critical component of the membrane-bound oxidase of phagocytes that generates superoxide. It is the terminal component of a respiratory chain that transfers single electrons from cytoplasmic NADPH across the plasma membrane to molecular oxygen on the exterior. Also functions as a voltage-gated proton channel that mediates the H(+) currents of resting phagocytes.
Gene References into Functions
  1. These results suggested that resveratrol strongly enhances the RA-induced O2(-)-generating activity via up-regulation of gp91-phox gene expression in U937 cells. PMID:29183727
  2. sub-vasomotor concentration of ET-1 leads to vascular dysfunction by impairing endothelium-dependent NO-mediated dilation via p38 kinase-mediated production of superoxide from NADPH oxidase following ETA receptor activation PMID:26211713
  3. activated during ischemia/reperfusion in a complement-dependent manner, and may contribute to the renal damage PMID:25017967
  4. Reactive oxygen species generated by NADPH oxidase contribute to the aberrant pulmonary arterial responses in piglets exposed to 3 days of hypoxia. PMID:18757525
  5. Upregulation of PPAR-gamma and NADPH oxidases are involved in restenosis. PMID:19562688

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Database Links

UNIGENE: Ssc.151

KEGG: ssc:397108

STRING: 9823.ENSSSCP00000029153

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products