AHTPTLEPEPFLYILGKQRMLEAQHRCYDRMQKLPPYQGEGLYCNRTWDGWSCWDDTPAG VLAEQYCPDYFPDFDAAEKVTKYCGEDGDWYRHPESNISWSNYTMCNAFTPDKLQNAYIL YYLAIVGHSLSILTLLISLGIFMFLRYFNLLAPFNALLYPTRSISCQRVTLHKNMFLTYV LNSIIIIVHLVVIVPNGELVKRDPPICKVLHFFHQYMMSCNYFWMLCEGVYLHTLIVVSV FAEGQRLWWYHVLGWGFPLIPTTAHAITRAVLFNDNCWLSVDTNLLYIIHGPVMAALVVN FFFLLNILRVLVKKLKESQEAESHMYLKAVRATLILVPLLGVQFVVLPWRPSTPLLGKIY DYVVHSLIHFQGFFVAIIYCFCNHEVQGALKRQWNQYQAQRWAGRRSTRAANAAAATAAA AAALAETVEIPVYICHQEPREEPAGEEPVVEVEGVEVIAMEVLEQETSA
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
This is a receptor for calcitonin. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. The calcitonin receptor is thought to couple to the heterotrimeric guanosine triphosphate-binding protein that is sensitive to cholera toxin. The receptor can also couple to an additional signaling pathway via a pertussis toxin-sensitive g protein in isolated osteoclasts and in LLC-PK1 cells.
Gene References into Functions
Intracoronary intermedin 1-47 augments cardiac perfusion and function in anesthetized pigs: role of calcitonin receptors and beta-adrenoreceptor-mediated nitric oxide release.PMID:19696365