Home
Product
Protein
Transmembrane Proteins
Recombinant Pig Beta-2 adrenergic receptor (ADRB2)

Recombinant Pig Beta-2 adrenergic receptor (ADRB2)

Code: CSB-CF630705PI

Rate （N/A）
Review （0）

Size:

20μg100μg

US$5622

Quantity:

Express system: in vitro E.coli expression system

Species: Sus scrofa (Pig)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

ADRB2

Uniprot NO.

Q28997

Species

Sus scrofa (Pig)

Source

in vitro E.coli expression system

Expression Region

1-418

Target Protein Sequence

MGQPGNRSVFLLAPNGSHAPDQDVPQERDEAWVVGMAIVMSLIVLAIVFGNVLVITAIAK FERLQTVTNYFITSLACADLVMGLAVVPFGASHILMKMWTFGSFWCEFWISIDVLCVTAS IETLCVIAVDRYLAITSPFKYQCLLTKNKARVVILMVWVVSGLISFLPIKMHWYQATHRE ALNCYAEEACCDFFTNQPYAIASSIVSFYLPLVVMVFVYSRVFQVARRQLQKIDKSEGRF HAQNLSQAEQDGRSGPGHRRSSKFCLKEHKALKTLGIIMGTFTLCWLPFFIVNIVHGIHD NLIPKEVYILLNWVGYVNSAFNPLIYCRSPDFRMAFQELLCLHRSSLKAYGNGCSSNSNG RTDYTGEQSGCYLGEEKDSERLCEDAPGPEGCAHRQGTVPDDSTDSQGRNCSTNDSML
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Beta-adrenergic receptors mediate the catecholamine-induced activation of adenylate cyclase through the action of G proteins. The beta-2-adrenergic receptor binds epinephrine with an approximately 30-fold greater affinity than it does norepinephrine.

Gene References into Functions

The Galphas and Galphaq peptides adopt different orientations in beta2-AR and V1AR, respectively. The beta2-AR/Galphas peptide interface is dominated by electrostatic interactions, whereas the V1AR/Galphaq peptide interactions are predominantly hydrophobic. PMID:27330078
A persistent B2R-beta2AR heterodimer was confirmed in bradykinin-stimulated and non-stimulated left ventricular myocardium. BK transactivation of beta2AR enhanced beta2AR-mediated release of tPA. PMID:25078038
These data collectively reveal the potential of beta2ARag to improve skin scarring. PMID:25050597
Beta(1)- and beta(2)-adrenoceptors contribute to the beta-feedforward coronary resistance vessel dilation during exercise. PMID:20035031
Prolactin infusion brought about the inhibition of a vasodilatory beta(2)-adrenergic receptor-mediated effect related to the NO intracellular pathway PMID:17463060
Intracoronary intermedin 1-47 augments cardiac perfusion and function in anesthetized pigs: role of calcitonin receptors and beta-adrenoreceptor-mediated nitric oxide release. PMID:19696365