Recombinant Pig B2 bradykinin receptor (BDKRB2)

Code: CSB-CF872392PI

Rate （N/A）
Review （0）

Size:

20μg100μg

US$5241

Quantity:

Express system: in vitro E.coli expression system

Species: Sus scrofa (Pig)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

BDKRB2

Uniprot NO.

Q9GLX8

Alternative Names

BDKRB2; B2 bradykinin receptor; B2R; BK-2 receptor

Species

Sus scrofa (Pig)

Source

in vitro E.coli expression system

Expression Region

1-367

Target Protein Sequence

MLNLTSQVPEPALNGTLPQSSSCFHSDWWNWLNTIQAPFLWVLFLLAALENIFVLSVFCL HKNSCTVAEIYLGNLAMADLILALGLPFWAITIANHFDWLFGEVLCRVVNTMIYMNLYSS ICFLMLVSIDRYLALVKTMSMGRMRGVRWAKLYSLVIWGCTLLLSSPMLAFRTMHEYAAE GHNVTACIIKYPSRSWMVFTNILLNSVGFLLPLSIITYCTVQILQVLRNNEMQKFKEIQT ERKATVLVLAVLLLFVVCWLPFQISTFLDTLLRLGVLSGCWDEHAVDVITQISSYVAYSN SGLNPLVYVIVGKRFRKKSREVYRVLCQKGGCMGEPVQMENSMGTLRTSISVERQIHKLQ DWAGKKQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Receptor for bradykinin. It is associated with G proteins that activate a phosphatidylinositol-calcium second messenger system.

Gene References into Functions

Bradykinin induces NO and PGF2alpha production via B2 receptor activation from cultured porcine basilar arterial endothelial cells PMID:24833299
A persistent B2R-beta2AR heterodimer was confirmed in bradykinin-stimulated and non-stimulated left ventricular myocardium. BK transactivation of beta2AR enhanced beta2AR-mediated release of tPA. PMID:25078038

Hide All

Subcellular Location

Cell membrane; Multi-pass membrane protein.

Protein Families

G-protein coupled receptor 1 family, Bradykinin receptor subfamily, BDKRB2 sub-subfamily

Database Links

UNIGENE: Ssc.15918

STRING: 9823.ENSSSCP00000029962

Promotions