Recombinant Pig B2 bradykinin receptor (BDKRB2)

Code: CSB-CF872392PI
Size:
20μg
20μg100μg
US$5241
Quantity:
Express system: in vitro E.coli expression system
Species: Sus scrofa (Pig)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
BDKRB2
Uniprot NO.
Alternative Names
BDKRB2; B2 bradykinin receptor; B2R; BK-2 receptor
Species
Sus scrofa (Pig)
Source
in vitro E.coli expression system
Expression Region
1-367
Target Protein Sequence
MLNLTSQVPEPALNGTLPQSSSCFHSDWWNWLNTIQAPFLWVLFLLAALENIFVLSVFCL HKNSCTVAEIYLGNLAMADLILALGLPFWAITIANHFDWLFGEVLCRVVNTMIYMNLYSS ICFLMLVSIDRYLALVKTMSMGRMRGVRWAKLYSLVIWGCTLLLSSPMLAFRTMHEYAAE GHNVTACIIKYPSRSWMVFTNILLNSVGFLLPLSIITYCTVQILQVLRNNEMQKFKEIQT ERKATVLVLAVLLLFVVCWLPFQISTFLDTLLRLGVLSGCWDEHAVDVITQISSYVAYSN SGLNPLVYVIVGKRFRKKSREVYRVLCQKGGCMGEPVQMENSMGTLRTSISVERQIHKLQ DWAGKKQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Receptor for bradykinin. It is associated with G proteins that activate a phosphatidylinositol-calcium second messenger system.
Gene References into Functions
  1. Bradykinin induces NO and PGF2alpha production via B2 receptor activation from cultured porcine basilar arterial endothelial cells PMID:24833299
  2. A persistent B2R-beta2AR heterodimer was confirmed in bradykinin-stimulated and non-stimulated left ventricular myocardium. BK transactivation of beta2AR enhanced beta2AR-mediated release of tPA. PMID:25078038

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family, Bradykinin receptor subfamily, BDKRB2 sub-subfamily
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products