Recombinant Pig ATP-binding cassette sub-family G member 2 (ABCG2)

Code: CSB-CF850738PI
Size:
20μg
20μg100μg
US$7403
Quantity:
Express system: in vitro E.coli expression system
Species: Sus scrofa (Pig)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
ABCG2
Uniprot NO.
Alternative Names
ABCG2; BMDP; Broad substrate specificity ATP-binding cassette transporter ABCG2; ATP-binding cassette sub-family G member 2; Brain multidrug resistance protein; Urate exporter; CD antigen CD338
Species
Sus scrofa (Pig)
Source
in vitro E.coli expression system
Expression Region
1-656
Target Protein Sequence
MSSNSYQVSIPMSKRNTNGLPGSSSNELKTSAGGAVLSFHDICYRVKVKSGFLFCRKTVE KEILTNINGIMKPGLNAILGPTGGGKSSLLDVLAARKDPHGLSGDVLINGAPRPANFKCN SGYVVQDDVVMGTLTVRENLQFSAALRLPTTMTNHEKNERINMVIQELGLDKVADSKVGT QFIRGVSGGERKRTSIAMELITDPSILFLDEPTTGLDSSTANAVLLLLKRMSKQGRTIIF SIHQPRYSIFKLFDSLTLLASGRLMFHGPAREALGYFASIGYNCEPYNNPADFFLDVING DSSAVVLSRADRDEGAQEPEEPPEKDTPLIDKLAAFYTNSSFFKDTKVELDQFSGGRKKK KSSVYKEVTYTTSFCHQLRWISRRSFKNLLGNPQASVAQIIVTIILGLVIGAIFYDLKND PSGIQNRAGVLFFLTTNQCFSSVSAVELLVVEKKLFIHEYISGYYRVSSYFFGKLLSDLL PMRMLPSIIFTCITYFLLGLKPAVGSFFIMMFTLMMVAYSASSMALAIAAGQSVVSVATL LMTISFVFMMIFSGLLVNLKTVVPWLSWLQYFSIPRYGFSALQYNEFLGQNFCPGLNVTT NNTCSFAICTGAEYLENQGISLSAWGLWQNHVALACMMVIFLTIAYLKLLLLKKYS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Broad substrate specificity ATP-dependent transporter of the ATP-binding cassette (ABC) family that actively extrudes a wide variety of physiological compounds, dietary toxins and xenobiotics from cells. Involved in porphyrin homeostasis, mediating the export of protoporphyrin IX (PPIX) from both mitochondria to cytosol and cytosol to extracellular space, it also functions in the cellular export of heme. Also mediates the efflux of sphingosine-1-P from cells. Acts as a urate exporter functioning in both renal and extrarenal urate excretion. In kidney, it also functions as a physiological exporter of the uremic toxin indoxyl sulfate. Also involved in the excretion of steroids like estrone 3-sulfate/E1S, 3beta-sulfooxy-androst-5-en-17-one/DHEAS, and other sulfate conjugates. Mediates the secretion of the riboflavin and biotin vitamins into milk. Extrudes pheophorbide a, a phototoxic porphyrin catabolite of chlorophyll, reducing its bioavailability. Plays an important role in the exclusion of xenobiotics from the brain. It confers to cells a resistance to multiple drugs and other xenobiotics including mitoxantrone, pheophorbide, camptothecin, methotrexate, azidothymidine, and the anthracyclines daunorubicin and doxorubicin, through the control of their efflux. In placenta, it limits the penetration of drugs from the maternal plasma into the fetus. May play a role in early stem cell self-renewal by blocking differentiation.
Gene References into Functions
  1. Inherently high expression of ABCG2 in endocardial endothelial cells protects them against apoptosis in presence of anticancer agents. PMID:26661076

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Apical cell membrane; Multi-pass membrane protein. Mitochondrion membrane; Multi-pass membrane protein.
Protein Families
ABC transporter superfamily, ABCG family, Eye pigment precursor importer (TC 3.A.1.204) subfamily
Tissue Specificity
High expression in brain, kidney and lung. Also expressed in livere, colon, small intestine, heart, skeletal muscle, spleen, stomach and pancreas.
Database Links

UNIGENE: Ssc.64

KEGG: ssc:397073

STRING: 9823.ENSSSCP00000028560

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products