Home
Product
Protein
Transmembrane Proteins
Recombinant Pig 5-hydroxytryptamine receptor 2A (HTR2A)

Recombinant Pig 5-hydroxytryptamine receptor 2A (HTR2A)

Code: CSB-CF010887PI

Rate （N/A）
Review （0）

Size:

20μg100μg

US$6011

Quantity:

Express system: in vitro E.coli expression system

Species: Sus scrofa (Pig)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

HTR2A

Uniprot NO.

P50129

Species

Sus scrofa (Pig)

Source

in vitro E.coli expression system

Expression Region

1-470

Target Protein Sequence

MDVLCEENTSLSSPTNSFMQLNDDTRLYHNDFNSGEANTSDAFNWTVDSENRTNLSCEGC LSPPCFSLLHLQEKNWSALLTAVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIAD MLLGFLVMPVSMLTILYGYRWPLPSKLCAVWIYLDVLFSTASIMHLCAISLDRYVAIQNP IHHRRFNSRTKAFLKIIAVWTISVGISMPIPVFGLQDDSKVFKEGSCLLADDNFVLIGSF VSFFIPLTIMVITYFLTIKSLQKEATLCVSDLGTRAKLASFSFLPQSSLSSEKLFQRSIH REPGSYGRRTMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICKESCNEDVIGAL LNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQCQYKENKKPLQLILVNTIPALAYKS SQLQTGQKENSKQDDKATENDCTMVALGKQHSEDAPADNSNTVNEKVSCV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

G-protein coupled receptor for 5-hydroxytryptamine (serotonin). Also functions as a receptor for various drugs and psychoactive substances, including mescaline, psilocybin, 1-(2,5-dimethoxy-4-iodophenyl)-2-aminopropane (DOI) and lysergic acid diethylamide (LSD). Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors. Beta-arrestin family members inhibit signaling via G proteins and mediate activation of alternative signaling pathways. Signaling activates phospholipase C and a phosphatidylinositol-calcium second messenger system that modulates the activity of phosphatidylinositol 3-kinase and promotes the release of Ca(2+) ions from intracellular stores. Affects neural activity, perception, cognition and mood. Plays a role in the regulation of behavior, including responses to anxiogenic situations and psychoactive substances. Plays a role in intestinal smooth muscle contraction, and may play a role in arterial vasoconstriction.

Gene References into Functions

5-HT2A receptor subtype is the predominant receptor mediating 5-HT responses in ureteral tissues PMID:29104045
The 5-HT(2A) receptor subtype is sensitive to elevated stretch. PMID:21865058
Early weaning results in less active behaviour, accompanied by lower 5-HT1A and higher 5-HT2A receptor mRNA expression in specific brain regions. PMID:18653286
excitatory 5-HT(2A) and inhibitory 5-HT(7) are present in the uterus of non-pregnant pigs. Endogenous 5-HT containing cells are mainly present in uterine glands of the pig PMID:18952076

Hide All

Subcellular Location

Cell membrane; Multi-pass membrane protein. Cell projection, axon. Cytoplasmic vesicle. Membrane, caveola. Cell projection, dendrite. Cell junction, synapse, presynapse.

Protein Families

G-protein coupled receptor 1 family

Database Links

UNIGENE: Ssc.16141

KEGG: ssc:397432

STRING: 9823.ENSSSCP00000010037

Promotions