MVSQTTSEVQPTMGVKIFSAGVAACLADIITFPLDTAKVRLQIQGEGQTSSTIRYKGVLG TITTLAKTEGLPKLYSGLPAGIQRQISFASLRIGLYDTVQEYFSSGKETPPTLVNRISAG LMTGGVAVFIGQPTEVVKVRLQAQSHLHGIKPRYTGTYNAYRIIATTESLSTLWKGTTPN LLRNVIINCTELVTYDLMKGALVNNQILADDVPCHLLSALVAGFCTTFLASPADVVKTRF INSLPGQYPSVPSCAMTMFTKEGPTAFFKGFVPSFLRLASWNVIMFVCFEQLKKELMKSR QTVDCTT
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Mitochondrial protein responsible for thermogenic respiration, a specialized capacity of brown adipose tissue and beige fat that participates in non-shivering adaptive thermogenesis to temperature and diet variations and more generally to the regulation of energy balance. Functions as a long-chain fatty acid/LCFA and proton symporter, simultaneously transporting one LCFA and one proton through the inner mitochondrial membrane. However, LCFAs remaining associated with the transporter via their hydrophobic tails, it results in an apparent transport of protons activated by LCFAs. Thereby, dissipates the mitochondrial proton gradient and converts the energy of substrate oxydation into heat instead of ATP. Regulates the production of reactive oxygen species/ROS by mitochondria.