Home
Product
Protein
Transmembrane Proteins
Recombinant Pan troglodytes Natural cytotoxicity triggering receptor 3 (NCR3)

Recombinant Pan troglodytes Natural cytotoxicity triggering receptor 3 (NCR3)

Code: CSB-CF015551EQV

Rate （N/A）
Review （0）

Size:

20μg100μg

US$3864

Quantity:

Express system: in vitro E.coli expression system

Species: Pan troglodytes (Chimpanzee)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

NCR3

Uniprot NO.

P61484

Species

Pan troglodytes (Chimpanzee)

Source

in vitro E.coli expression system

Expression Region

19-201

Target Protein Sequence

LWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNETPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLGAGTVLLLRAGFYAVSFLSVAVGSTVYYQGKCLTWKGPRRQLPAVVPAPLPPPCGSSAQLLPPVPGG
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Cell membrane receptor of natural killer/NK cells that is activated by binding of extracellular ligands including BAG6 and NCR3LG1. Stimulates NK cells cytotoxicity toward neighboring cells producing these ligands. It controls, for instance, NK cells cytotoxicity against tumor cells. Engagement of NCR3 by BAG6 also promotes myeloid dendritic cells (DC) maturation, both through killing DCs that did not acquire a mature phenotype, and inducing the release by NK cells of TNFA and IFNG that promote DC maturation.

Gene References into Functions

phenotypic, molecular, and functional characterization for triggering molecules (NKp46, NKp30 NKp80, and NKG2D; in this AIDS-resistant species, relevant differences to human NK cells involve NKp80 and particularly NKp30 PMID:17237420

Hide All

Subcellular Location

Cell membrane; Single-pass type I membrane protein.

Protein Families

Natural cytotoxicity receptor (NCR) family

Database Links

UNIGENE: Ptr.6189

KEGG: ptr:449613

STRING: 9598.ENSPTRP00000030663

Promotions