Home
Product
Protein
Transmembrane Proteins
Recombinant Pan troglodytes C-X-C chemokine receptor type 1 (CXCR1)

Recombinant Pan troglodytes C-X-C chemokine receptor type 1 (CXCR1)

Code: CSB-CF345918EQV

Rate （N/A）
Review （0）

Size:

20μg100μg

US$5113

Quantity:

Express system: in vitro E.coli expression system

Species: Pan troglodytes (Chimpanzee)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

CXCR1

Uniprot NO.

P55920

Alternative Names

CXCR1; IL8RA; C-X-C chemokine receptor type 1; CXC-R1; CXCR-1; High affinity interleukin-8 receptor A; IL-8R A; IL-8 receptor type 1; CD antigen CD181

Species

Pan troglodytes (Chimpanzee)

Source

in vitro E.coli expression system

Expression Region

1-350

Target Protein Sequence

MSNITDPQMWDFDDLNFTGMPPTDEGYSPCRLETETLNKYVVIITYALVFLLSLLGNSLV MLVILYSRVGRSVTDVYLLNLALADLLFALTLPIWAASKVNGWIFGTFLCKVVSLLKEVN FYSGILLLACISVDRYLAIVHATRTLTQKRHLVKFVCLGCWGLSMNLSLPFFLFRQAYHP NNSSPVCYEVLGNDTAKWRMVLRILPHTFGFIVPLFVMLFCYGFTLRTLFKAHMGQKHRA MRVIFAVVLIFLLCWLPYNLVLLADTLMRTQVIQESCERRNNIGRALDATEILGFLHSCL NPIIYAFIGQNFRHGFLKILAMHGLVSKEFLARHRVTSYTSSSVNVSSNL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Receptor to interleukin-8, which is a powerful neutrophils chemotactic factor. Binding of IL-8 to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activate a phosphatidylinositol-calcium second messenger system. This receptor binds to IL-8 with a high affinity and to MGSA (GRO) with a low affinity.

Subcellular Location

Cell membrane; Multi-pass membrane protein.

Protein Families

G-protein coupled receptor 1 family

Database Links

UNIGENE: Ptr.6172

KEGG: ptr:470645

STRING: 9598.ENSPTRP00000022066

Promotions