Home
Product
Protein
Transmembrane Proteins
Recombinant Nicotiana tabacum Alternative oxidase 1, mitochondrial (AOX1)

Recombinant Nicotiana tabacum Alternative oxidase 1, mitochondrial (AOX1)

Code: CSB-CF672566NHE

Rate （N/A）
Review （0）

Size:

20μg100μg

US$4620

Quantity:

Express system: in vitro E.coli expression system

Species: Nicotiana tabacum (Common tobacco)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

AOX1

Uniprot NO.

Q41224

Alternative Names

AOX1; Ubiquinol oxidase 1, mitochondrial; Alternative oxidase 1

Species

Nicotiana tabacum (Common tobacco)

Source

in vitro E.coli expression system

Expression Region

70-353

Target Protein Sequence

AMSMALNDKQHDKKAENGSAAATGGGDGGDEKSVVSYWGVQPSKVTKEDGTEWKWNCFRP WETYKADLSIDLTKHHAPTTFLDKFAYWTVKSLRYPTDIFFQRRYGCRAMMLETVAAVPG MVGGMLLHCKSLRRFEQSGGWIKTLLDEAENERMHLMTFMEVAKPNWYERALVFAVQGVF FNAYFVTYLLSPKLAHRIVGYLEEEAIHSYTEFLKELDKGNIENVPAPAIAIDYCRLPKD STLLDVVLVVRADEAHHRDVNHFASDIHYQGQQLKDSPAPIGYH
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Catalyzes the cyanide-resistant oxidation of ubiquinol and the reduction of molecular oxygen to water, but does not translocate protons and consequently is not linked to oxidative phosphorylation. May increase respiration when the cytochrome respiratory pathway is restricted, or in response to low temperatures.

Subcellular Location

Mitochondrion inner membrane; Multi-pass membrane protein. Note=Mitochondrial, possibly in the inner surface of the inner mitochondrial membrane.

Protein Families

Alternative oxidase family

Database Links

UNIGENE: Nta.464

Promotions