MDTNMSLLMNKSAVNLMNVSGSTQSVSAGYIVLDVFSYLIFAVTFVLGVLGNGLVIWVAG FRMKHTVTTISYLNLAIADFCFTSTLPFYIASMVMGGHWPFGWFMCKFIYTVIDINLFGS VFLIALIALDRCICVLHPVWAQNHRTVSLAKKVIIVPWICAFLLTLPVIIRLTTVPNSRL GPGKTACTFDFSPWTKDPVEKRKVAVTMLTVRGIIRFIIGFSTPMSIVAICYGLITTKIH RQGLIKSSRPLRVLSFVVAAFFLCWCPFQVVALISTIQVRERLKNMTPGIVTALKITSPL AFFNSCLNPMLYVFMGQDFRERLIHSLPASLERALTEDSAQTSDTGTNLGTNSTSLSENT LNAM
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
High affinity receptor for N-formyl-methionyl peptides (fMLP), which are powerful neutrophil chemotactic factors. Binding of fMLP to the receptor stimulates intracellular calcium mobilization and superoxide anion release. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. Receptor for TAFA4, mediates its effects on chemoattracting macrophages, promoting phagocytosis and increasing ROS release.
Gene References into Functions
FPR1-deficient mice showed a slight but significant decrease of demyelination in the corpus callosum and reduced glial cell activation.PMID:28466255
the FPR1 downstream signaling pathways were competitively inhibited by HCH6-1. Furthermore, HCH6-1 prevented pulmonary neutrophil infiltration and edema along with alveolar damage in LPS-induced ALI in mice. Our findings suggest that HCH6-1, a FPR1 antagonist, may have potential as a new therapeutic agent for treating FPR1-involved inflammatory lung diseasesPMID:28232203
Intravital TPLSM revealed that formyl-peptide-FPR1 signaling is responsible for regulating neutrophil chemotaxis to allow migration into the necrotic area in hepatic ischemia-reperfusion injuryPMID:28062700
Formylated MHC class Ib binding peptides activate both human and mouse neutrophils primarily through FPR1.PMID:27907124
Blocking of FPR1 completely abrogated the fMet-Leu-Phe-, gliadin- and synthetic peptide-induced migration.PMID:26378785
these results highlight the importance of FPR1 in chemotherapy-induced anticancer immune responses.PMID:26516201
Ovalbumininduced airway inflammation is mediated by upregulation of the TLR2/MyD88/NFkappaB signaling pathway and inhibition of LXA4R.PMID:25760938
Deficiency of formyl peptide receptor 1 is associated with increased inflammation and enhanced liver injury after LPS-stimulationPMID:24956481
these findings identify a novel role of FPR1 as pattern recognition receptors for perceiving the enteric microbiota that promotes repair of mucosal wounds via generation of reactive oxygen species from the enterocyte NOX1.PMID:24192910
Further, these results reveal Fpr1 as a major mediator of host commensal interaction during dysbiosis.PMID:24034617
The mechanism involved impaired early neutrophil recruitment to the liver with Fpr1 being sole receptor for neutrophils to sense Listeria chemoattractant signals and for production of bactericidal superoxide.PMID:23139859
findings may have clinical significance because current smokers and subjects with emphysema showed increased FPR expression in bronchoalveolar fluids and on peripheral neutrophilsPMID:22461430
Neutrophil migration into the inflamed mouse colon does not depend on FPR1, but FPR1 contributes in other pathological mechanisms that are harmful during acute inflammation but are protective during chronic inflammation.PMID:22383080
Enteric commensal bacteria induce extracellular signal-regulated kinase pathway signaling via formyl peptide receptor-dependent redox modulation of dual specific phosphatase 3PMID:21921027
Fpr1 has a role in modulation of anxiety-like behavior and fear memory by regulating glucocorticoid productionPMID:21484271
The N-formylpeptide receptor (FPR) and a second G(i)-coupled receptor mediate fMet-Leu-Phe-stimulated activation of NADPH oxidase in murine neutrophils.PMID:12470609
Leukocyte antiadhesive and anti-inflammatory actions of annexin 1 involve this receptor.PMID:12560218
a novel TLR4-linked signaling pathway that selectively couples to the stabilization of FPR1 mRNA.PMID:17277163
The mechanisms through which these two small GTPases Rac1 and Rac2 mediate free barbed ends generation downstream of the formyl-methionyl-leucyl-phenylalanine receptor, was investigated.PMID:17954607
study found that mFPR1 is responsible for the high potency of fMIVIL and fMIFL; the ability of mFPR1 to detect bacterially derived formyl peptides indicates that this important host defense mechanism is conserved in micePMID:18606697
Show
More
Hide
All
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Expressed in neutrophils, dendritic cells, microglia, spleen, lung and liver. Low level of expression in the vomeronasal organ.