Recombinant Mouse fMet-Leu-Phe receptor (Fpr1)

Code: CSB-CF008854MO
Size:
20μg
20μg100μg
US$5218
Quantity:
Express system: in vitro E.coli expression system
Species: Mus musculus (Mouse)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
Fpr1
Uniprot NO.
Alternative Names
Fpr1; fMet-Leu-Phe receptor; fMLP receptor; N-formyl peptide receptor; FPR; N-formylpeptide chemoattractant receptor
Species
Mus musculus (Mouse)
Source
in vitro E.coli expression system
Expression Region
1-364
Target Protein Sequence
MDTNMSLLMNKSAVNLMNVSGSTQSVSAGYIVLDVFSYLIFAVTFVLGVLGNGLVIWVAG FRMKHTVTTISYLNLAIADFCFTSTLPFYIASMVMGGHWPFGWFMCKFIYTVIDINLFGS VFLIALIALDRCICVLHPVWAQNHRTVSLAKKVIIVPWICAFLLTLPVIIRLTTVPNSRL GPGKTACTFDFSPWTKDPVEKRKVAVTMLTVRGIIRFIIGFSTPMSIVAICYGLITTKIH RQGLIKSSRPLRVLSFVVAAFFLCWCPFQVVALISTIQVRERLKNMTPGIVTALKITSPL AFFNSCLNPMLYVFMGQDFRERLIHSLPASLERALTEDSAQTSDTGTNLGTNSTSLSENT LNAM
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
High affinity receptor for N-formyl-methionyl peptides (fMLP), which are powerful neutrophil chemotactic factors. Binding of fMLP to the receptor stimulates intracellular calcium mobilization and superoxide anion release. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. Receptor for TAFA4, mediates its effects on chemoattracting macrophages, promoting phagocytosis and increasing ROS release.
Gene References into Functions
  1. FPR1-deficient mice showed a slight but significant decrease of demyelination in the corpus callosum and reduced glial cell activation. PMID:28466255
  2. the FPR1 downstream signaling pathways were competitively inhibited by HCH6-1. Furthermore, HCH6-1 prevented pulmonary neutrophil infiltration and edema along with alveolar damage in LPS-induced ALI in mice. Our findings suggest that HCH6-1, a FPR1 antagonist, may have potential as a new therapeutic agent for treating FPR1-involved inflammatory lung diseases PMID:28232203
  3. Intravital TPLSM revealed that formyl-peptide-FPR1 signaling is responsible for regulating neutrophil chemotaxis to allow migration into the necrotic area in hepatic ischemia-reperfusion injury PMID:28062700
  4. Formylated MHC class Ib binding peptides activate both human and mouse neutrophils primarily through FPR1. PMID:27907124
  5. Blocking of FPR1 completely abrogated the fMet-Leu-Phe-, gliadin- and synthetic peptide-induced migration. PMID:26378785
  6. these results highlight the importance of FPR1 in chemotherapy-induced anticancer immune responses. PMID:26516201
  7. Ovalbumininduced airway inflammation is mediated by upregulation of the TLR2/MyD88/NFkappaB signaling pathway and inhibition of LXA4R. PMID:25760938
  8. Deficiency of formyl peptide receptor 1 is associated with increased inflammation and enhanced liver injury after LPS-stimulation PMID:24956481
  9. these findings identify a novel role of FPR1 as pattern recognition receptors for perceiving the enteric microbiota that promotes repair of mucosal wounds via generation of reactive oxygen species from the enterocyte NOX1. PMID:24192910
  10. Further, these results reveal Fpr1 as a major mediator of host commensal interaction during dysbiosis. PMID:24034617
  11. The mechanism involved impaired early neutrophil recruitment to the liver with Fpr1 being sole receptor for neutrophils to sense Listeria chemoattractant signals and for production of bactericidal superoxide. PMID:23139859
  12. findings may have clinical significance because current smokers and subjects with emphysema showed increased FPR expression in bronchoalveolar fluids and on peripheral neutrophils PMID:22461430
  13. Neutrophil migration into the inflamed mouse colon does not depend on FPR1, but FPR1 contributes in other pathological mechanisms that are harmful during acute inflammation but are protective during chronic inflammation. PMID:22383080
  14. Enteric commensal bacteria induce extracellular signal-regulated kinase pathway signaling via formyl peptide receptor-dependent redox modulation of dual specific phosphatase 3 PMID:21921027
  15. Fpr1 has a role in modulation of anxiety-like behavior and fear memory by regulating glucocorticoid production PMID:21484271
  16. The N-formylpeptide receptor (FPR) and a second G(i)-coupled receptor mediate fMet-Leu-Phe-stimulated activation of NADPH oxidase in murine neutrophils. PMID:12470609
  17. Leukocyte antiadhesive and anti-inflammatory actions of annexin 1 involve this receptor. PMID:12560218
  18. a novel TLR4-linked signaling pathway that selectively couples to the stabilization of FPR1 mRNA. PMID:17277163
  19. The mechanisms through which these two small GTPases Rac1 and Rac2 mediate free barbed ends generation downstream of the formyl-methionyl-leucyl-phenylalanine receptor, was investigated. PMID:17954607
  20. study found that mFPR1 is responsible for the high potency of fMIVIL and fMIFL; the ability of mFPR1 to detect bacterially derived formyl peptides indicates that this important host defense mechanism is conserved in mice PMID:18606697

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Expressed in neutrophils, dendritic cells, microglia, spleen, lung and liver. Low level of expression in the vomeronasal organ.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products