Vamp2; Syb2; Vesicle-associated membrane protein 2; VAMP-2; Synaptobrevin-2
Species
Mus musculus (Mouse)
Source
in vitro E.coli expression system
Expression Region
2-116
Target Protein Sequence
SATAATVPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Involved in the targeting and/or fusion of transport vesicles to their target membrane. Major SNARE protein of synaptic vesicles which mediates fusion of synaptic vesicles to release neurotransmitters. Essential for fast vesicular exocytosis and activity-dependent neurotransmitter release as well as fast endocytosis that mediates rapid reuse of synaptic vesicles. Modulates the gating characteristics of the delayed rectifier voltage-dependent potassium channel KCNB1.
Gene References into Functions
These observations provide evidence that the synaptobrevin-2 transmembrane domain catalyzes the membrane fusion process by its structural flexibility, actively setting the pace of fusion pore expansion.PMID:27343350
Thus, lipid-anchored syb2 provides little or no support for exocytosis, and anchoring syb2 to a membrane by a TMD greatly improves its functionPMID:26663078
Vamp2 mutations impair the ability of Munc18-1 to promote trans-SNARE zippering. These mutations inhibit spontaneous as well as evoked neurotransmitter release, providing evidence for the Vamp2-regulating function of Munc18-1 in synaptic exocytosis.PMID:26572858
These results provide a novel molecular mechanism for autocrine negative feedback regulation of insulin secretion.PMID:26585489
Results suggest that side chains in the syb2 transmembrane domain influence the kinetics of exocytosis by perturbing the packing of the surrounding lipidsPMID:26153704
Here we report on transgenic mice expressing a ubiquitinated synaptic vesicle protein (Ub(G76V)-GFP-Syb2) that develop progressive degeneration of motor nerve terminals.PMID:26290230
VAMP2 is the major v-SNARE involved in GLUT4 trafficking to the surface of 3T3-L1 adipocytes.PMID:25501368
These results indicate a role for the syb2 TMD in nascent fusion pores, but in a very different structural arrangement from that of the syntaxin transmembrane domains.PMID:25855187
Clustering was dependent on specific interactions of native alpha-synuclein with both synaptobrevin-2/VAMP2 and anionic lipidsPMID:23638301
Findings indicate an essential role for VAMP2 in GLP-1 exocytosis from the GLUTag L cell in response to a variety of established secretagogues.PMID:24356748
synaptobrevin2 is expressed in cytotoxic T lymphocytes and exclusively localized on granzyme B-containing lytic granules.PMID:23385584
Data suggest that tryptophans W89/W90 in juxtamembrane region/transmembrane domain of Syb2 act as fusion clamp in chromaffin cells; in mutant protein, alanines A89/A90 promote spontaneous membrane fusion.PMID:23178715
The tryptophan moiety in SybII keeps secretory vesicles in the release-ready state and support a model wherein tryptophan-mediated protein-lipid interactions assist in bridging the apposing membranes before fusion.PMID:23136435
microelectrode array measurements in specific hippocampal subregions of VAMP2(+/-) mice showed significant reductions in potassium-evoked glutamate releasePMID:22183055
VAMP2 and VAMP3 are expressed in JG cells, but only VAMP2 is targeted to renin-containing granules and mediates the stimulatory effect of cAMP on renin exocytosis.PMID:21708949
Two copies of spH per synaptic vesicles (SV) fully rescued evoked fusion whereas SVs expressing only one spH were unable to rapidly fuse upon stimulation.PMID:21844343
T3 may promote glucose uptake via enhancing insulin-induced phosphorylation of Akt and subsequent translocations of VAMP2 and glucose transporter GLUT4 in adipocytes.PMID:21792921
multiple SybII actions determine the exquisite temporal regulation of neuronal signaling.PMID:20685972
Results suggest a model in which the positively charged VAMP2 and syntaxin juxtamembrane regions facilitate fusion by bridging the negatively charged vesicle and plasma membrane leaflets.PMID:19812247
essential for two fast synapse-specific membrane trafficking reactions: fast exocytosis for neurotransmitter release and fast endocytosis that mediates rapid reuse of synaptic vesiclesPMID:15475946
may function in catalyzing fusion reactions and stabilizing fusion intermediates but is not absolutely required for synaptic fusionPMID:11691998
Show
More
Hide
All
Subcellular Location
Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane; Single-pass type IV membrane protein. Cell membrane.
Protein Families
Synaptobrevin family
Tissue Specificity
Expressed in the outer plexiform layer of the retina (at protein level).