Recombinant Mouse Vasopressin V1a receptor (Avpr1a)

Code: CSB-CF737082MO
Size:
20μg
20μg100μg
US$5660
Quantity:
Express system: in vitro E.coli expression system
Species: Mus musculus (Mouse)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
Avpr1a
Uniprot NO.
Alternative Names
Avpr1a; Vasopressin V1a receptor; V1aR; AVPR V1a; Antidiuretic hormone receptor 1a; Vascular/hepatic-type arginine vasopressin receptor
Species
Mus musculus (Mouse)
Source
in vitro E.coli expression system
Expression Region
1-423
Target Protein Sequence
MSFPRGSHDLPAGNSSPWWPLTTEGANSSREAAGLGEGGSPPGDVRNEELAKLEVTVLAV IFVVAVLGNSSVLLALHRTPRKTSRMHLFIRHLSLADLAVAFFQVLPQLCWDITYRFRGP DWLCRVVKHLQVFAMFASSYMLVVMTADRYIAVCHPLKTLQQPARRSRLMIAASWGLSFV LSIPQYFIFSVIEFEVNNGTKAQDCWATFIPPWGTRAYVTWMTSGVFVVPVIILGTCYGF ICYHIWRNVRGKTASRQSKGGKGSGEAAGPFHKGLLVTPCVSSVKSISRAKIRTVKMTFV IVSAYILCWTPFFIVQMWSVWDTNFVWTDSENPSTTITALLASLNSCCNPWIYMFFSGHL LQDCVQSFPCCQSIAQKFAKDDSDSMSRRQTSYSNNRSPTNSTGTWKDSPKSSKSIRFIP VST
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Receptor for arginine vasopressin. The activity of this receptor is mediated by G proteins which activate a phosphatidyl-inositol-calcium second messenger system. Involved in social memory formation.
Gene References into Functions
  1. depressive-like behavior alters oxytocin receptor (OxtR) and arginine vasopressin receptor type 1a (AvpR1a) gene expression in the hippocampus (HC) of male mice. PMID:27525673
  2. The results suggest that vasopressin receptor is required for conditioned effects of an ethanol-associated social stimulus PMID:26282397
  3. Local over-expression of the AVP receptor V1a enhances regeneration of atrophic muscle. PMID:24971321
  4. Oxytocin inhibits ASICs through V1A receptors in sensory neurons modulating nociception and pain. PMID:24641084
  5. Transaortic constriction decreased heart function and betaAR density. It increased V1AR expression. V1AR decreased cardiomyocyte betaAR ligand affinity, betaAR-induced calcium signaling and cAMP in a Gq protein-independent/G protein receptor kinase-dependent way. PMID:25205804
  6. Using homologous recombination in mice, we reveal the modest contribution of proximal 5' flanking sequences to species differences in V1aR distribution, and confirm that variation in V1aR distribution impacts stress-coping in the forced swim test. PMID:24009523
  7. Central V1a receptors might play an important role in suppressing baroreflex control of heart rate during cerebral activation at the onset of voluntary locomotion. PMID:23671158
  8. V1aR signaling may be fundamentally important for the expression of AQP2 in the collecting ducts during control conditions and dehydration PMID:22968856
  9. Females, but not males, show an orienting bias for odors previously paired with the mother, which is eliminated by V1aR signaling. PMID:23261858
  10. individual differences in developmentally transient V1aR signaling and even sex may alter the development of excitation and inhibition balance in the neocortex PMID:22820266
  11. These results suggest that vasopressin directly regulates the nucleocytoplasmic transport of mineralocorticoid receptors via the V1aR in the intercalated cells of the collecting ducts. PMID:22811487
  12. we do find evidence for the role of V1a receptors in predicting maternal behavior in mice PMID:22300676
  13. Total elimination of Avpr1a had no effect on fear conditioning in mice PMID:21668734
  14. Results suggest that variations of estrogen alpha/beta receptor levels are associated with differences in social interaction through the OT and AVP systems, by upregulating gene expression for those peptides and the oxytocin and vasopressin 1a receptors. PMID:21749489
  15. The V1a receptor (V1aR) for vasopressin, a potent myogenic-promoting factor that stimulates differentiation and hypertrophy in vitro, is expressed in mouse skeletal muscle and modulated during regeneration after experimental injury. PMID:21816902
  16. Aldosterone requires vasopressin V1a receptors on intercalated cells to mediate acid-base homeostasis. PMID:21415155
  17. Suggest that the V1aR is involved in the elevation of arterial blood pressure caused by dietary salt and that a V1aR antagonist could have significant therapeutic potential in the treatment of hypertension. PMID:20118201
  18. Oxytocin-induced analgesia and scratching are mediated by the vasopressin-1A receptor in the mouse. PMID:20554879
  19. Vasopressin receptor 1a-mediated negative regulation of B cell receptor signaling. PMID:12576226
  20. The results of this study suggest that the V1aR controls spatial memory in mice. PMID:15036628
  21. These results demonstrate that the V1aR in the lateral septum plays a critical role in the neural processing of social stimuli required for complex social behavior. PMID:16102534
  22. Results indicate that the vasopressin V1a receptor plays an important role in normal resting arterial blood pressure regulation mainly by its regulation of circulating blood volume and baroreflex sensitivity. PMID:16682631
  23. [Arg8]Vasopressin could modulate the lipid metabolism by the antilipolytic action and the synthesis of bile acid via the V1a receptor PMID:17021052
  24. Avpr1a(-/-) mice have a longer circadian tau and subtle olfactory deficits; however, social aggression, anxiety-like behavior and social recognition are unaffected. PMID:17083331
  25. V1A receptor in the central nervous system is involved in the regulation of the heart rate via the baroreflex arc. PMID:17224142
  26. V1aR may be involved in the regulation of social interaction, and V1aR KO mice could be used as an animal model of psychiatric disorders associated with social behavior deficits, such as autism and schizophrenia. PMID:17227684
  27. one of the AVP-resistance conditions resulting from deficiency of the V1a receptor leads to decreased plasma volume as well as impaired glucose homeostasis, which can progress to obesity under conditions of increased calorie intake PMID:17303660
  28. Arginine-vasopressin plays a physiological role via the V1a receptor in regulating both protein catabolism and glucose homeostasis. PMID:17379633
  29. argipressin Avpr1a signaling may play an important role in the preference for ethanol PMID:18305023
  30. These data indicate that AVP regulates body fluid homeostasis and GFR via the V1aR in MD cells by activating RAS and subsequently the V2R-AQP2 system. PMID:18448596

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family, Vasopressin/oxytocin receptor subfamily
Database Links

UNIGENE: Mm.4351

KEGG: mmu:54140

STRING: 10090.ENSMUSP00000020323

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products