MSFPRGSHDLPAGNSSPWWPLTTEGANSSREAAGLGEGGSPPGDVRNEELAKLEVTVLAV IFVVAVLGNSSVLLALHRTPRKTSRMHLFIRHLSLADLAVAFFQVLPQLCWDITYRFRGP DWLCRVVKHLQVFAMFASSYMLVVMTADRYIAVCHPLKTLQQPARRSRLMIAASWGLSFV LSIPQYFIFSVIEFEVNNGTKAQDCWATFIPPWGTRAYVTWMTSGVFVVPVIILGTCYGF ICYHIWRNVRGKTASRQSKGGKGSGEAAGPFHKGLLVTPCVSSVKSISRAKIRTVKMTFV IVSAYILCWTPFFIVQMWSVWDTNFVWTDSENPSTTITALLASLNSCCNPWIYMFFSGHL LQDCVQSFPCCQSIAQKFAKDDSDSMSRRQTSYSNNRSPTNSTGTWKDSPKSSKSIRFIP VST
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Receptor for arginine vasopressin. The activity of this receptor is mediated by G proteins which activate a phosphatidyl-inositol-calcium second messenger system. Involved in social memory formation.
Gene References into Functions
depressive-like behavior alters oxytocin receptor (OxtR) and arginine vasopressin receptor type 1a (AvpR1a) gene expression in the hippocampus (HC) of male mice.PMID:27525673
The results suggest that vasopressin receptor is required for conditioned effects of an ethanol-associated social stimulusPMID:26282397
Local over-expression of the AVP receptor V1a enhances regeneration of atrophic muscle.PMID:24971321
Oxytocin inhibits ASICs through V1A receptors in sensory neurons modulating nociception and pain.PMID:24641084
Transaortic constriction decreased heart function and betaAR density. It increased V1AR expression. V1AR decreased cardiomyocyte betaAR ligand affinity, betaAR-induced calcium signaling and cAMP in a Gq protein-independent/G protein receptor kinase-dependent way.PMID:25205804
Using homologous recombination in mice, we reveal the modest contribution of proximal 5' flanking sequences to species differences in V1aR distribution, and confirm that variation in V1aR distribution impacts stress-coping in the forced swim test.PMID:24009523
Central V1a receptors might play an important role in suppressing baroreflex control of heart rate during cerebral activation at the onset of voluntary locomotion.PMID:23671158
V1aR signaling may be fundamentally important for the expression of AQP2 in the collecting ducts during control conditions and dehydrationPMID:22968856
Females, but not males, show an orienting bias for odors previously paired with the mother, which is eliminated by V1aR signaling.PMID:23261858
individual differences in developmentally transient V1aR signaling and even sex may alter the development of excitation and inhibition balance in the neocortexPMID:22820266
These results suggest that vasopressin directly regulates the nucleocytoplasmic transport of mineralocorticoid receptors via the V1aR in the intercalated cells of the collecting ducts.PMID:22811487
we do find evidence for the role of V1a receptors in predicting maternal behavior in micePMID:22300676
Total elimination of Avpr1a had no effect on fear conditioning in micePMID:21668734
Results suggest that variations of estrogen alpha/beta receptor levels are associated with differences in social interaction through the OT and AVP systems, by upregulating gene expression for those peptides and the oxytocin and vasopressin 1a receptors.PMID:21749489
The V1a receptor (V1aR) for vasopressin, a potent myogenic-promoting factor that stimulates differentiation and hypertrophy in vitro, is expressed in mouse skeletal muscle and modulated during regeneration after experimental injury.PMID:21816902
Aldosterone requires vasopressin V1a receptors on intercalated cells to mediate acid-base homeostasis.PMID:21415155
Suggest that the V1aR is involved in the elevation of arterial blood pressure caused by dietary salt and that a V1aR antagonist could have significant therapeutic potential in the treatment of hypertension.PMID:20118201
Oxytocin-induced analgesia and scratching are mediated by the vasopressin-1A receptor in the mouse.PMID:20554879
Vasopressin receptor 1a-mediated negative regulation of B cell receptor signaling.PMID:12576226
The results of this study suggest that the V1aR controls spatial memory in mice.PMID:15036628
These results demonstrate that the V1aR in the lateral septum plays a critical role in the neural processing of social stimuli required for complex social behavior.PMID:16102534
Results indicate that the vasopressin V1a receptor plays an important role in normal resting arterial blood pressure regulation mainly by its regulation of circulating blood volume and baroreflex sensitivity.PMID:16682631
[Arg8]Vasopressin could modulate the lipid metabolism by the antilipolytic action and the synthesis of bile acid via the V1a receptorPMID:17021052
Avpr1a(-/-) mice have a longer circadian tau and subtle olfactory deficits; however, social aggression, anxiety-like behavior and social recognition are unaffected.PMID:17083331
V1A receptor in the central nervous system is involved in the regulation of the heart rate via the baroreflex arc.PMID:17224142
V1aR may be involved in the regulation of social interaction, and V1aR KO mice could be used as an animal model of psychiatric disorders associated with social behavior deficits, such as autism and schizophrenia.PMID:17227684
one of the AVP-resistance conditions resulting from deficiency of the V1a receptor leads to decreased plasma volume as well as impaired glucose homeostasis, which can progress to obesity under conditions of increased calorie intakePMID:17303660
Arginine-vasopressin plays a physiological role via the V1a receptor in regulating both protein catabolism and glucose homeostasis.PMID:17379633
argipressin Avpr1a signaling may play an important role in the preference for ethanolPMID:18305023
These data indicate that AVP regulates body fluid homeostasis and GFR via the V1aR in MD cells by activating RAS and subsequently the V2R-AQP2 system.PMID:18448596