Home
Product
Protein
Transmembrane Proteins
Recombinant Mouse UDP-glucuronosyltransferase 1-1 (Ugt1a1)

Recombinant Mouse UDP-glucuronosyltransferase 1-1 (Ugt1a1)

Code: CSB-CF737232MO

Rate （N/A）
Review （0）

Size:

20μg100μg

US$6281

Quantity:

Express system: in vitro E.coli expression system

Species: Mus musculus (Mouse)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

Ugt1a1

Uniprot NO.

Q63886

Alternative Names

Ugt1a1; Ugt1; UDP-glucuronosyltransferase 1A1; UGT1A1; UDP-glucuronosyltransferase 1-1; UDPGT 1-1; UGT1*1; UGT1-01; UGT1.1; UGTBR1

Species

Mus musculus (Mouse)

Source

in vitro E.coli expression system

Expression Region

30-535

Target Protein Sequence

GRLLVFPMDGSHWLSMLGVIQQLQQKGHEVVVIAPEASIHIKEGSFYTLRKFPVPFQKEN VTATLVELGRTAFNQDSFLLRVVKIYMKVKRDSSMLLAGCSHLLHNAEFMASLEESHFDA LLTDPFLPCGSIVAQYLTVPTVYFLNKLPCSLDSEATQCPVPLSYVPKSLSFNSDRMNFL QRVKNVLLAVSENFMCRVVYSPYGSLATEILQKEVTVQDLLSPASIWLMRSDFVKDYPRP IMPNMVFIGGINCLQKKPLSQEFEAYVNASGEHGIVVFSLGSMVSEIPEKKAMEIAEALG RIPQTVLWRYTGTRPSNLAKNTILVKWLPQNDLLGHPKTRAFITHSGSHGIYEGICNGVP MVMMPLFGDQMDNAKRMETRGAGVTLNVLEMTADDLENALKTVINNKSYKENIMRLSSLH KDRPIEPLDLAVFWVEYVMRHKGAPHLRPAAHDLTWYQYHSLDVIGFLLAIVLTVVFIVF KCCAYGCRKCFGGKGRVKKSHKSKTH
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

UDP-glucuronosyltransferase (UGT) that catalyzes phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase the metabolite's water solubility, thereby facilitating excretion into either the urine or bile. Essential for the elimination and detoxification of drugs, xenobiotics and endogenous compounds. Catalyzes the glucuronidation of endogenous estrogen hormones such as estradiol, estrone and estriol. Involved in the glucuronidation of bilirubin, a degradation product occurring in the normal catabolic pathway that breaks down heme in vertebrates. Also catalyzes the glucuronidation the isoflavones genistein, daidzein, glycitein, formononetin, biochanin A and prunetin, which are phytoestrogens with anticancer and cardiovascular properties. Involved in the glucuronidation of the AGTR1 angiotensin receptor antagonist losartan, a drug which can inhibit the effect of angiotensin II. Involved in the biotransformation of 7-ethyl-10-hydroxycamptothecin (SN-38), the pharmacologically active metabolite of the anticancer drug irinotecan.

Gene References into Functions

data confirm that Ugt1a proteins are present and active in preimplantation murine embryos and point to a potential role for these proteins in implantation and early embryonic and fetal development PMID:25200869
Intestinal induction of the UGT1A1 gene may serve to limit toxicity and improve the efficacy associated with CPT-11 colorectal cancer treatment. PMID:24191041
Data observed that OSM positively augmented the CAR and UGT1A1 expressions and CAR-mediated signaling in vivo and in vitro, through cross talk between the nuclear CAR receptor and the plasma membrane OSM receptor, via the MAPK cascade. PMID:20197307
suppression of AhR signaling pathway is associated with the down-regulation of Ugt1a mRNA during urinary bladder carcinogenesis. PMID:19880377
Nrf2-Keap1-dependent UGT1A1 induction by prooxidants might represent a key adaptive response to cellular oxidative stress PMID:17259171
the loss of UGT1A function in Ugt1(-/-) mice leads to a metabolic syndrome that can serve as a model to further investigate the toxicities associated with unconjugated bilirubin and the impact of this disease in humans. PMID:18180294