Tnfrsf9; Cd137; Ila; Ly63; Tumor necrosis factor receptor superfamily member 9; 4-1BB ligand receptor; T-cell antigen 4-1BB; CD antigen CD137
Species
Mus musculus (Mouse)
Source
in vitro E.coli expression system
Expression Region
24-256
Target Protein Sequence
VQNSCDNCQPGTFCRKYNPVCKSCPPSTFSSIGGQPNCNICRVCAGYFRFKKFCSSTHNAECECIEGFHCLGPQCTRCEKDCRPGQELTKQGCKTCSLGTFNDQNGTGVCRPWTNCSLDGRSVLKTGTTEKDVVCGPPVVSFSPSTTISVTPEGGPGGHSLQVLTLFLALTSALLLALIFITLLFSVLKWIRKKFPHIFKQPFKKTTGAAQEEDACSCRCPQEEEGGGGGYEL
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Receptor for TNFSF9/4-1BBL. Possibly active during T cell activation.
Gene References into Functions
m4-1BBL and Gal-9 act together to aid aggregation of m4-1BB monomers to efficiently initiate m4-1BB signaling.PMID:29242193
the CD137-CD137L pathway plays an important role in regulating VSMC phenotype transformation via activation of NFATc1 signaling pathway.PMID:28770466
Tonic 4-1BB costimulation in chimeric antigen receptors impedes T cell survival and is vector-dependent.PMID:28978471
fatty acid metabolism plays a crucial role in enhancing the cell cycle progression of anti-CD3-activated CD8(+) T cells in vitro and the anti-apoptotic effects of 4-1BB signaling on these cells.PMID:26972770
CD137 signaling activates the pro-angiogenic Smad1/5 pathway, induces the phosphorylation of Smad1/5 and nuclear translocation of p-Smad1/5, which in turn promotes the expression and translocation of NFATc1. Blocking CD137 signaling with inhibitory anti-CD137 antibody could inhibit this activation and attenuated agonist anti-CD137 antibody-induced angiogenesis.PMID:28288971
the role of CD137-CRDI (cysteine rich domain I) in the binding of CD137-CD137L was further investigated.PMID:27430526
Data indicate that anti-CD137 agonists can function as inhibitors of CD137L signaling, resulting in the creation of tumor microenvironments unfavorable for tumor immune evasion.PMID:28923858
This study discovers the 4-1BB pathway signaling enhances inflammatory response and promotes pulmonary fibrosis induced by crystalline silica.PMID:27698940
Constitutive interaction between 4-1BB and 4-1BBL on murine LPS-activated bone marrow dendritic cells masks detection of 4-1BBL by TKS-1 but not 19H3 antibody.PMID:28789924
results indicate that one important diabetogenic function of CD137 is to promote the expansion and accumulation of beta cell-autoreactive CD8 T cells, and in the absence of CD137 or its interaction with CD137 ligand, type 1 diabetes progression is suppressedPMID:28363905
High CD137 expression is associated with neoplasms.PMID:28082401
Ly6C, 4-1BB, and KLRG1 have roles in the activation of lamina propria lymphocytes in the small intestine in a mouse model of Crohn's diseasePMID:28011265
CD137 Regulates NFATc1 Expression in Mouse VSMCs through TRAF6/NF-kappaB p65 Signaling Pathway.PMID:26600673
4-1BB triggering preferentially enhances the expansion of CD8+ T cells through the amplification of autocrine IL-2/IL-2R signaling loop.PMID:25962156
c-IAP ubiquitin protein ligase activity is required for 4-1BB signaling and CD8(+) memory T-cell survival.PMID:26096449
we conclude that in vivo 4-1BB signaling of myeloid cells negatively regulates peripheral T cell responsesPMID:25601928
activation of CD137 signaling decreases the stability of advanced atherosclerotic plaques via its combined effects on Teff cells, vascular smooth muscle cells, and macrophagesPMID:25059229
4-1BB mediates the inflammatory responses in obese skeletal muscle by interacting with its ligand 4-1BBL on macrophages.PMID:24453430
CD137-CD137L interactions mediated via regulation of CyPA contribute to the progression of atherosclerosis.PMID:24520398
action of agonist anti-4-1BB in suppressing autoimmune and allergic inflammation was completely dependent on Galectin-9 (Gal-9). Gal-9 directly bound to 4-1BB, in a site distinct from the binding site of antibodies and the natural ligand of 4-1BBPMID:24958847
sCD137 can actively suppress highly purified CD4 T cells in a CD137L dependent fashion.PMID:24145149
monocytes interact with iNKT cells to increase expression of 4-1BBL and 4-1BB, and in conjunction with this pathway, maintain their numbers at baseline.PMID:24639347
4-1BB signaling enhances the proliferation of activated CD8(+) T cells.PMID:23874982
Results found the activation of CD137L reverse signaling by CD137 resulted in a decrease in cell adhesion to the fibronectin-coated culture basement, thus causing detachment-induced cell death.PMID:23925549
CD137 plays an essential role in the resolution of acute DSS-induced intestinal inflammation in micePMID:24023849
During CD134 plus CD137 dual costimulation, IFN-gamma interacts with IL-2 through distinct mechanisms to program maximal expression of effector molecules in antigen-responding T-cells.PMID:23295363
Sjogren's syndrome-like autoimmune sialadenitis in MRL-Faslpr mice is associated with expression of glucocorticoid-induced TNF receptor-related protein (GITR) ligand and 4-1BB ligand.PMID:23301790
Taken together, these data provide evidence that the 4-1BB signal is an important regulator of gammadelta T cellsPMID:23640752
CD137-CD137L interactions increase myelopoiesis during infectionPMID:23519951
4-1BB/4-1BBL-mediated bidirectional signaling in adipocytes/macrophages promotes adipose inflammation.PMID:23316108
TRAF1 and LSP1 cooperate downstream of 4-1BB to activate ERK signaling and down-modulate the levels of Bim leading to enhanced T cell survival.PMID:23446150
The CD137 receptor/ligand system may be a mediator of neuroinflammatory and neurodegenerative disease, by activating microglia which in turn kill oligodendrocytes.PMID:22799524
Systemic 4-1BB activation induces a novel T cell phenotype driven by high expression of Eomesodermin.PMID:23547098
4-1BB signaling plays a role in activating maternal CD8+ T cells from their hypo-responsiveness that are reactive with allogeneic fetal tissue and probably with conventional antigens.PMID:23029041
CD137L regulates many functions of myelin oligodendrocyte glycoprotein-specific T-cells that contribute to Experimental autoimmune encephalomyelitisPMID:23238738
After stimulation of total mononuclear cells or CD4+ T cells, surface expression of 4-1BB can be used to detect activated Foxp3+ regulatory T cells (Treg) within a defined window.PMID:23162126
Results indicate that 4-1BBL/4-1BB contributes to cell survival during antigen-independent IL-2/mAb-complex-dependent T-cell expansion.PMID:21946662
Data indicate that hypoxia as sensed by the HIF-1alpha system increases expression of CD137 on tumor-infiltrating lymphocytes that become selectively responsive to the immunotherapeutic effects of anti-CD137 agonist monoclonal antibodies.PMID:22719018
deficiency does not affect development of airway inflammation or respiratory tolerance inductionPMID:22519594
CD137 has a role in breast cancer and its specific antibody can be used to enhance trastuzumab efficacyPMID:22326955
conditioned medium from Lewis Lung Carcinoma cells caused significant upregulation of 4-1BB in mast cellsPMID:22343053
these data demonstrate that 4-1BB and 4-1BBL do not play a strong or dominant role in driving the generation of high frequencies of vaccinia virus -specific CD8 T cells.PMID:22037570
The findings suggest that 4-1BB and 4-1BBL may be useful therapeutic targets for combating obesity-induced inflammation and metabolic disorders.PMID:21998397
the therapeutic outcome of 4-1BB triggering is determined by whether the protective immunity generated against the virus was beneficially altered by the 4-1BB triggering.PMID:21700476
T-cell co-inhibitory blockade combined with alphaCTLA-4 and active co-stimulation with alpha4-1BB promotes rejection of B16 melanoma in with a vaccine; KLRG1 is a useful marker for monitoring the anti-tumor immune response elicited by this therapyPMID:21559358
the current study identifies for the first time a specific CD134 plus CD137 costimulatory pathway and an intracellular mechanism relying on Eomesodermin that induces cytotoxic CD4 Th1 cellsPMID:21880986
Membrane and soluble forms of Tnfrsf9 are expressed in specific cell types of the uterus and conceptus during the progression of implantation in mice and possibly have an important function in this process.PMID:21560035
4-1BB signaling seems to modulate autoimmune encephalitis by a number of mechanisms, and modulation of the T helper (Th)17 cell versus regulatory T cell (Treg) balance is one of those mechanisms.PMID:21715692
4-1BB signaling synergizes with programmed death ligand 1 blockade to augment CD8 T cell responses during chronic viral infection.PMID:21742975
granulocyte and macrophage populations of murine bone marrow cells are regulated by G-CSF and CD137 proteinPMID:21179444