QGTNSISESLKLRRRVRETDKNCSEGLYQGGPFCCQPCQPGKKKVEDCKMNGGTPTCAPCTEGKEYMDKNHYADKCRRCTLCDEEHGLEVETNCTLTQNTKCKCKPDFYCDSPGCEHCVRCASCEHGTLEPCTATSNTNCRKQSPRNRLWLLTILVLLIPLVFIYRKYRKRKCWKRRQDDPESRTSSRETIPMNASNLSLSKYIPRIAEDMTIQEAKKFARENNIKEGKIDEIMHDSIQDTAEQKVQLLLCWYQSHGKSDAYQDLIKGLKKAECRRTLDKFQDMVQKDLGKSTPDTGNENEGQCLE
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Receptor for TNFSF6/FASLG. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. FAS-mediated apoptosis may have a role in the induction of peripheral tolerance, in the antigen-stimulated suicide of mature T-cells, or both.
Gene References into Functions
our computational and experimental approach identified Fas as a regulator of the Th17-to-Th1 cell balance by controlling the availability of opposing STAT1 and STAT3 to have a direct impact on autoimmunity.PMID:29562202
FGF21 alleviated atherosclerosis by ameliorating Fas-mediated apoptosis in apoE-/- mice.PMID:30157856
TPD7 altered the extrinsic apoptosis pathway by upregulating Fas expression.PMID:29901176
In conclusion, these data demonstrate that murine herpesvirus 68-immortalized SL-1 cells can be recognized and controlled by specific cytotoxic T cells through CD95/CD95L-mediated apoptosis.PMID:28516317
Findings indicate that induction of apoptosis through Fas is dependent on receptor palmitoylation in primary immune cells, and Fas may prevent autoimmunity by mechanisms other than inducing apoptosis.PMID:28008916
Both Sharpin/Fas and Sharpin/Fasl compound mutant mice developed an auto-inflammatory phenotype similar to that seen in Sharpin null mice, indicating that initiation of apoptosis by FAS signalling is likely not involved in the pathogenesis of this disease.PMID:28094869
Tag7 activates lymphocytes capable of Fasl-Fas-dependent contact killing of virus-infected cells.PMID:29083508
leucine deprivation induces the expression of miR-212-5p in a GCN2/ATF4-dependent manner. miR-212-5p suppresses lipid accumulation in liver by targeting FAS and SCD1 under both normal diet and high-fat diet conditions.PMID:28667176
Our data show that loss of Fas activity strongly affects the early development of atopic dermatitis (AD) by leading to Th2-dominant inflammation characterized by dermal infiltration of CD4+ T cells, neutrophils and increased skin expression of Th2 cytokines.However, Fas/FasL-apoptotic pathway is also involved in restricting tissue remodelling and dermal fibrosis during AD.PMID:28434120
Hrd1-null B cells exhibited high Fas expression during activation and rapidly underwent Fas-mediated apoptosis, which could be largely inhibited by FasL neutralization. Fas mutation in Hrd1 KO mice abrogated the increase in B-cell AICD. We identified Hrd1 as the first E3 ubiquitin ligase of the death receptor Fas and Hrd1-mediated Fas destruction as a molecular mechanism in regulating B-cell immunity.PMID:27573825
FAS contributes to mitochondrial dysfunction, steatosis development, and insulin resistance under high fat diet.PMID:28883393
These findings reveal a role for MOAP-1 in Fas signaling in the liver by promoting MTCH2-mediated tBid recruitment to mitochondria.PMID:27320914
The in vivo delivery of CRISPR/Cas9 could maintain liver homeostasis and protect hepatocytes from Fas-mediated cell apoptosis in the fulminant hepatic failure model.PMID:27585307
This study demonstrated that Ischemic neurons release sFasL, which contributes to M1-microglial polarization.PMID:27283206
results indicate that IL-1beta, produced by the inflammasome and Fas-dependent mechanisms, contributes cooperatively to the Th17/Th1 induction during bacterial infection. This study provides a deeper understanding of the molecular mechanisms underlying Th17/Th1 induction during pathogenic microbial infections in vivo.PMID:28674179
this study shows that CD95-mediated calcium signaling promotes Th17 cell trafficking to inflamed organs in lupus-prone micePMID:27438772
accelerating effects of Tlr9 deficiencyPMID:28278279
K8/K18-dependent PKCdelta- and ASMase-mediated modulation of lipid raft size can explain the more prominent FasR-mediated signaling resulting from K8/K18 loss.PMID:27422101
Data show that TCF1 proteindeficiency relieved most manifestations of autoimmune lymphoproliferative syndrome (ALPS)-like phenotype, which were caused by Fas protein mutation in TCF1(-/-) lpr/lpr mice.PMID:28349581
Results indicate that the close interaction between Thy-1 and Fas in lipid rafts regulates fibroblast apoptosis, and decreased fibroblast apoptosis associated with myofibroblast accumulation in mice lacking Thy-1.PMID:28165468
Fas/FasL Complex Promotes Proliferation and Migration of Brain Endothelial Cells Via FADD-FLIP-TRAF-NF-kappaB PathwayPMID:25427888
Cardiac Fas-dependent and mitochondria-dependent apoptotic pathways were activated in transgenic mice with Huntington's disease.PMID:25800750
The MWM showed that compared with FAS- and FASL-knockout mice treated with sevoflurane, sevoflurane treatment of wild-type mice significantly prolonged the escape latency and reduced platform crossing times.PMID:26782453
the individual functions of the NF-kappaB family members NF-kappaB1, NF-kappaB2 and c-REL in the various autoimmune pathologies of Fas(lpr/lpr) mutant mice, were investigated.PMID:26084385
When Bax(-/-)Bak(-/-) murine embryonic stem cells (ESCs) are stimulated to differentiate, a subpopulation fails to do so and instead upregulates FAS in a p53-dependent manner to trigger Bax/Bak-dependent apoptosis.PMID:26585277
These results demonstrate that during ectromelia virus infection, Fas/FasL can regulate development of tolerogenic DCs and Tregs, leading to an ineffective immune response.PMID:26780774
Data determined the transmembrane domain structure of Fas and showed that the trimer assembly, which is mediated by a proline-containing motif, is essential for Fas signaling providing structural explanation for many known cancer mutations in this domain.PMID:26853147
Impaired Fas-Fas Ligand Interactions Result in Greater Recurrent Herpetic Stromal Keratitis in MicePMID:26504854
miR-150 deficiency prevents Fas-induced hepatocyte apoptosis and liver injury through regulation of the Akt pathwayPMID:26196694
CD47 deficiency ameliorates lupus nephritis in Fas(lpr) mice via suppression of IgG autoantibody production.PMID:26095930
The upregulation of p-FADD/FADD ratio and NF-kappaB in mouse hippocampus after Kainic acid treatmentPMID:26044520
demonstrates that Fas/FasL pathway during ectromelia virus infection of the lungs plays an important role in controlling local inflammatory response and mounting of antiviral responsePMID:25873756
Mice with the Fas(lpr) gene developed severe systemic lupus erythematosus with renal dysfunction and inflammatory responses in the lung and kidney. By contrast, mice with the Fas(+) gene showed disease-related abnormalities in the liver and joints.PMID:25941813
Occlusive lung arterial lesions triggering pulmonary arterial hypertension developed in a new model of endothelial-targeted, Fas-induced apoptosis transgenic mice.PMID:25879383
Gene silencing of liver Fas expression completely attenuated apoptotic and necrotic cell death.PMID:25601293
Our results demonstrate that Fas/FasL can regulate development of tolerogenic dendritic cells and expansion of Tregs early during HSV-2 infection, which further influences effective anti-viral response.PMID:25129477
our data support a model in which IFNgamma- and Fas/FasL-dependent activation of intratumoral Mvarphis by CD8(+) T cells promotes severe intraocular inflammation that indirectly eliminates intraocular tumors by inducing phthisis.PMID:25248763
Meningococcal capsular polysaccharide-loaded vaccine nanoparticles induce expression of CD95.PMID:24981893
These data provide the first in vivo genetic evidence that neutrophil lifespan is controlled by death receptor signaling and provide a mechanism to account for neutrophil resistance to Fas stimulation during infection.PMID:25473101
Intestinal expression of Fas and Fas ligand is upregulated by bacterial signaling through TLR4 and TLR5, with activation of Fas modulating intestinal TLR-mediated inflammation.PMID:25378591
overexpression of Fas/FasL is associated with infectious complications and severity of experimental severe acute pancreatitis by promoting apoptosis of lymphocytesPMID:24566874
No significant association between FAS-670G/A polymorphism and susceptibility to autoimmune hepatitis was found.PMID:24629822
a key role of MK2 and FasR in the regulation and limitation of the immune response in the CNSPMID:24964076
These data show that loss of Fas activity specifically in chondrocytes prolonged the life span of chondrocytes and that Fas synergized with TNFalpha signaling to mediate chondrocyte apoptosis.PMID:24677136
Although expression of Fas and TNF-R1 was proportionate to fractional apoptosis, cell death was dominated by spontaneous apoptosis in stem cell mobilization.PMID:24566711
Data suggest that toll-like receptor 3 (TLR3), phosphatidylinositol 3-kinase (PI3K), survivin, Fas ligand (FasL), and CD95 (Fas) genes are involved in the development of cervical cancer.PMID:25106857
The Fas KO mice spontaneously develop blepharitis with not only autoimmune inflammation with deposition of auto-antibody but also allergic inflammation with infiltration by eosinophils and show to increase serum level of IgE and IgG1.PMID:23220580
D-cyclins repress the expression of the death receptor Fas and its ligand, FasLPMID:25087893
Data indicate that dendritic cells (DCs)-specific CD95 (Fas) expression plays a role in regulation of antiviral responses and suggests a strategy for stimulation of T cells for virus clearance in chronically infected animal and human.PMID:24912151
Combined adenovirus-mediated artificial microRNAs targeting mfgl2, mFas, and mTNFR1 protect against fulminant hepatic failure in mice.PMID:24303082
Show
More
Hide
All
Subcellular Location
Cell membrane; Single-pass type I membrane protein. Membrane raft.
Tissue Specificity
Detected in various tissues including thymus, liver, lung, heart, and adult ovary.