Home
Product
Protein
Transmembrane Proteins
Recombinant Mouse Tumor necrosis factor ligand superfamily member 8 (Tnfsf8)

Recombinant Mouse Tumor necrosis factor ligand superfamily member 8 (Tnfsf8)

Code: CSB-CF023996MO

Rate （N/A）
Review （0）

Size:

20μg100μg

US$4283

Quantity:

Express system: in vitro E.coli expression system

Species: Mus musculus (Mouse)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

Tnfsf8

Uniprot NO.

P32972

Alternative Names

Tnfsf8; Cd30l; Cd30lg; Tumor necrosis factor ligand superfamily member 8; CD30 ligand; CD30-L; CD antigen CD153

Species

Mus musculus (Mouse)

Source

in vitro E.coli expression system

Expression Region

1-239

Target Protein Sequence

MEPGLQQAGSCGAPSPDPAMQVQPGSVASPWRSTRPWRSTSRSYFYLSTTALVCLVVAVAIILVLVVQKKDSTPNTTEKAPLKGGNCSEDLFCTLKSTPSKKSWAYLQVSKHLNNTKLSWNEDGTIHGLIYQDGNLIVQFPGLYFIVCQLQFLVQCSNHSVDLTLQLLINSKIKKQTLVTVCESGVQSKNIYQNLSQFLLHYLQVNSTISVRVDNFQYVDTNTFPLDNVLSVFLYSSSD
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Cytokine that binds to TNFRSF8/CD30. Induces proliferation of T-cells.

Gene References into Functions

Altered expression of CD30L and IL-3 may be potential biomarkers for hepatotoxicity induced by D. bulbifera. PMID:24647110
It is shown here that CD30L knock out (KO) mice are highly susceptible to primary infection with Listeria monocytogenes as assessed by the survival rate. PMID:21699557
Modulation of CD30L/CD30 signaling by soluble CD30 could be a novel biological therapy for inflammatory diseases associated with Th17 responses. PMID:21068411
Characterization of the murine CD30 ligand (CD153) gene: gene structure and expression. PMID:12392508
CD30L is required for generation of long-lived memory CD8+ T cells; CD30L signaling triggers homing receptors for T(central memory) cells. PMID:16177108
Signaling executed by CD30positive T cell interaction with CD30Lpositive T cells plays a critical role in amplification of T helper type (Th)1 responses able to produce interferon-gamma against Mycobacterium bovis bacillus Calmette-Guerin infection. PMID:18941223