Recombinant Mouse Tumor necrosis factor ligand superfamily member 8 (Tnfsf8)

Code: CSB-CF023996MO
Size:
20μg
20μg100μg
US$4283
Quantity:
Express system: in vitro E.coli expression system
Species: Mus musculus (Mouse)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
Tnfsf8
Uniprot NO.
Alternative Names
Tnfsf8; Cd30l; Cd30lg; Tumor necrosis factor ligand superfamily member 8; CD30 ligand; CD30-L; CD antigen CD153
Species
Mus musculus (Mouse)
Source
in vitro E.coli expression system
Expression Region
1-239
Target Protein Sequence
MEPGLQQAGSCGAPSPDPAMQVQPGSVASPWRSTRPWRSTSRSYFYLSTTALVCLVVAVAIILVLVVQKKDSTPNTTEKAPLKGGNCSEDLFCTLKSTPSKKSWAYLQVSKHLNNTKLSWNEDGTIHGLIYQDGNLIVQFPGLYFIVCQLQFLVQCSNHSVDLTLQLLINSKIKKQTLVTVCESGVQSKNIYQNLSQFLLHYLQVNSTISVRVDNFQYVDTNTFPLDNVLSVFLYSSSD
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Cytokine that binds to TNFRSF8/CD30. Induces proliferation of T-cells.
Gene References into Functions
  1. Altered expression of CD30L and IL-3 may be potential biomarkers for hepatotoxicity induced by D. bulbifera. PMID:24647110
  2. It is shown here that CD30L knock out (KO) mice are highly susceptible to primary infection with Listeria monocytogenes as assessed by the survival rate. PMID:21699557
  3. Modulation of CD30L/CD30 signaling by soluble CD30 could be a novel biological therapy for inflammatory diseases associated with Th17 responses. PMID:21068411
  4. Characterization of the murine CD30 ligand (CD153) gene: gene structure and expression. PMID:12392508
  5. CD30L is required for generation of long-lived memory CD8+ T cells; CD30L signaling triggers homing receptors for T(central memory) cells. PMID:16177108
  6. Signaling executed by CD30positive T cell interaction with CD30Lpositive T cells plays a critical role in amplification of T helper type (Th)1 responses able to produce interferon-gamma against Mycobacterium bovis bacillus Calmette-Guerin infection. PMID:18941223

Show More

Hide All

Subcellular Location
Membrane; Single-pass type II membrane protein.
Protein Families
Tumor necrosis factor family
Database Links

UNIGENE: Mm.4664

KEGG: mmu:21949

STRING: 10090.ENSMUSP00000030047

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products