Tnfsf4; Ox40l; Txgp1l; Tumor necrosis factor ligand superfamily member 4; OX40 ligand; OX40L; CD antigen CD252
Species
Mus musculus (Mouse)
Source
in vitro E.coli expression system
Expression Region
1-198
Target Protein Sequence
MEGEGVQPLDENLENGSRPRFKWKKTLRLVVSGIKGAGMLLCFIYVCLQLSSSPAKDPPIQRLRGAVTRCEDGQLFISSYKNEYQTMEVQNNSVVIKCDGLYIIYLKGSFFQEVKIDLHFREDHNPISIPMLNDGRRIVFTVVASLAFKDKVYLTVNAPDTLCEHLQINDGELIVVQLTPGYCAPEGSYHSTVNQVPL
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Cytokine that binds to TNFRSF4. Co-stimulates T-cell proliferation and cytokine production.
Gene References into Functions
these findings demonstrate the utility of soluble OX40 L and JAG1 to induce TCR-independent regulatory T-cells proliferationPMID:28045060
The OX40L expression is induced on the bronchiolar progenitors for the antiviral immunity during the infectious process. However, these defense-like host responses lead to more extensive infection with the influenza virus owing to the induced OX40L with alpha-2,6 sialic acid modification, which augments the interaction with the viral hemagglutinin.PMID:26976612
Rhinovirus infection interferes with induction of tolerance to aeroantigens through OX40 ligand, thymic stromal lymphopoietin, and IL-33PMID:26100084
intestinal Th2 priming is initiated by an autocrine/paracrine acting CD4(+) Th cell-intrinsic IL-4 program that is controlled by DC OX40L, and not by NKT, gammadelta T, or ILC cells.PMID:24781052
a critical role of OX40L presented by the activated basophils to initiate Th2 responses in an allergic asthma model, implicating OX40-OX40L signaling as a potential therapeutic target in the treatment of allergic airway inflammation.PMID:25839234
The majority of transferred CD40L(-/-) T cells in Rag-1(-/-) B6 mice were differentiated to CD44(high).PMID:24254032
The need for additional immune suppression in the intestine reflects commensal microbe-driven T-cell activation through the accessory costimulation molecules ICOSL and OX40L in B7 deprived mice.PMID:25002484
we identify a previously unknown role for OX40L in steady-state bone homeostasisPMID:24469824
Data indicate that OX40L contributes to both the development of Th2 cells and secondary Th2 responses induced by KLH-pulsed CD8- cDCs in vivo.PMID:24462862
These results showed a critical role for OX40L- and Jagged1-induced cosignaling in GM-BMDC-induced Treg expansion.PMID:23630352
engagement of OX40L selectively suppresses Fyn-initiated signals required for MC degranulation and serves to limit immediate hypersensitivityPMID:22564682
Present findings suggest a role for the OX40L-derived immune response and epistatic genetic effect in immune-mediated pathogenesis of PAH.PMID:22171643
The vascular OX40/OX40L system plays an important role in the formation of vasa vasorum and subsequent atherosclerosis.PMID:20584752
our data provide an in vivo role for the OX40/OX40L system in the innate immune response during polymicrobial sepsisPMID:20844189
Tumor necrosis factor ligand OX40L-expressing Langerhans cells play a mandatory role in the induction of regulatory T cells in ultraviolet B immunosuppressed mice.PMID:20400709
Constitutive interaction of OX40 ligand with OX40 during immune regulation is linked to the development of autoimmune-like diseases in OX40L-transgenic mice.PMID:12370402
Costimulation via OX40L expressed by B cells is sufficient to determine the extent of primary CD4 cell expansion and Th2 cytokine secretion.PMID:12668647
Critical role for OX40 ligand in the development of pathogenic Th2 cells in a murine model of asthma.PMID:12672051
Engagement of OX40 by an OX40L:Ig fusion protein drives IFN-gamma production by CD4+ T cells and reduces eosinophilia and the burden of Cryptococcus neoformans in the lung.PMID:12794142
A null allele at OX40L completely prevents diabetes development in nonobese diabetic mice and strongly reduces its incidence in a T cell receptor transgenic model, while paradoxically sustaining the long-term progression to autoimmune destruction.PMID:14662903
OX40-OX40L interaction affects both regulatory and nonregulatory T cells by influencing suppression, susceptibility to suppression, and clonal expansion.PMID:15004159
OX40 and OX40L interactions form a late checkpoint in diabetes development and are realistic targets for therapeutic intervention.PMID:15368274
neonatal CD4+ CD3- cells up-regulate both CD30L and OX40L after adoptive transfer into an adult recipientPMID:16920944
OX40 ligand (OX40L) is required for optimal T helper (Th) type 2 cell priming and memory Th2 responses in vivo; dependence upon OX40L is predominantly due to the provision of signaling through OX40 rather than retrograde signaling dendritic cells.PMID:17785785
These results show a critical role for OX40L on DCs, via binding to OX40 on NKT cells and CD4+ T cells, in the induction of antitumor immunity in tumor-bearing mice.PMID:17975668
OX40 ligand (OX40L) is a critical in vivo mediator of TSLP-mediated Th2 responses.PMID:18060034