Recombinant Mouse Tumor necrosis factor ligand superfamily member 4 (Tnfsf4)

CSB-CF023994MO
Size:
20μg
20μg100μg
US$3976
Quantity:
Express system: in vitro E.coli expression system
Species: Mus musculus (Mouse)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Orders can only be placed from within the U.S.

Product Details

Target Names
Tnfsf4
Uniprot NO.
Species
Mus musculus (Mouse)
Source
in vitro E.coli expression system
Expression Region
1-198
Target Protein Sequence
MEGEGVQPLDENLENGSRPRFKWKKTLRLVVSGIKGAGMLLCFIYVCLQLSSSPAKDPPIQRLRGAVTRCEDGQLFISSYKNEYQTMEVQNNSVVIKCDGLYIIYLKGSFFQEVKIDLHFREDHNPISIPMLNDGRRIVFTVVASLAFKDKVYLTVNAPDTLCEHLQINDGELIVVQLTPGYCAPEGSYHSTVNQVPL
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Description

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function
Cytokine that binds to TNFRSF4. Co-stimulates T-cell proliferation and cytokine production.
Gene References into Functions
  1. these findings demonstrate the utility of soluble OX40 L and JAG1 to induce TCR-independent regulatory T-cells proliferation PMID:28045060
  2. The OX40L expression is induced on the bronchiolar progenitors for the antiviral immunity during the infectious process. However, these defense-like host responses lead to more extensive infection with the influenza virus owing to the induced OX40L with alpha-2,6 sialic acid modification, which augments the interaction with the viral hemagglutinin. PMID:26976612
  3. Rhinovirus infection interferes with induction of tolerance to aeroantigens through OX40 ligand, thymic stromal lymphopoietin, and IL-33 PMID:26100084
  4. intestinal Th2 priming is initiated by an autocrine/paracrine acting CD4(+) Th cell-intrinsic IL-4 program that is controlled by DC OX40L, and not by NKT, gammadelta T, or ILC cells. PMID:24781052
  5. a critical role of OX40L presented by the activated basophils to initiate Th2 responses in an allergic asthma model, implicating OX40-OX40L signaling as a potential therapeutic target in the treatment of allergic airway inflammation. PMID:25839234
  6. The majority of transferred CD40L(-/-) T cells in Rag-1(-/-) B6 mice were differentiated to CD44(high). PMID:24254032
  7. The need for additional immune suppression in the intestine reflects commensal microbe-driven T-cell activation through the accessory costimulation molecules ICOSL and OX40L in B7 deprived mice. PMID:25002484
  8. we identify a previously unknown role for OX40L in steady-state bone homeostasis PMID:24469824
  9. Data indicate that OX40L contributes to both the development of Th2 cells and secondary Th2 responses induced by KLH-pulsed CD8- cDCs in vivo. PMID:24462862
  10. These results showed a critical role for OX40L- and Jagged1-induced cosignaling in GM-BMDC-induced Treg expansion. PMID:23630352
  11. engagement of OX40L selectively suppresses Fyn-initiated signals required for MC degranulation and serves to limit immediate hypersensitivity PMID:22564682
  12. Present findings suggest a role for the OX40L-derived immune response and epistatic genetic effect in immune-mediated pathogenesis of PAH. PMID:22171643
  13. The vascular OX40/OX40L system plays an important role in the formation of vasa vasorum and subsequent atherosclerosis. PMID:20584752
  14. our data provide an in vivo role for the OX40/OX40L system in the innate immune response during polymicrobial sepsis PMID:20844189
  15. Tumor necrosis factor ligand OX40L-expressing Langerhans cells play a mandatory role in the induction of regulatory T cells in ultraviolet B immunosuppressed mice. PMID:20400709
  16. Constitutive interaction of OX40 ligand with OX40 during immune regulation is linked to the development of autoimmune-like diseases in OX40L-transgenic mice. PMID:12370402
  17. Costimulation via OX40L expressed by B cells is sufficient to determine the extent of primary CD4 cell expansion and Th2 cytokine secretion. PMID:12668647
  18. Critical role for OX40 ligand in the development of pathogenic Th2 cells in a murine model of asthma. PMID:12672051
  19. Engagement of OX40 by an OX40L:Ig fusion protein drives IFN-gamma production by CD4+ T cells and reduces eosinophilia and the burden of Cryptococcus neoformans in the lung. PMID:12794142
  20. A null allele at OX40L completely prevents diabetes development in nonobese diabetic mice and strongly reduces its incidence in a T cell receptor transgenic model, while paradoxically sustaining the long-term progression to autoimmune destruction. PMID:14662903
  21. OX40-OX40L interaction affects both regulatory and nonregulatory T cells by influencing suppression, susceptibility to suppression, and clonal expansion. PMID:15004159
  22. OX40 and OX40L interactions form a late checkpoint in diabetes development and are realistic targets for therapeutic intervention. PMID:15368274
  23. neonatal CD4+ CD3- cells up-regulate both CD30L and OX40L after adoptive transfer into an adult recipient PMID:16920944
  24. OX40 ligand (OX40L) is required for optimal T helper (Th) type 2 cell priming and memory Th2 responses in vivo; dependence upon OX40L is predominantly due to the provision of signaling through OX40 rather than retrograde signaling dendritic cells. PMID:17785785
  25. These results show a critical role for OX40L on DCs, via binding to OX40 on NKT cells and CD4+ T cells, in the induction of antitumor immunity in tumor-bearing mice. PMID:17975668
  26. OX40 ligand (OX40L) is a critical in vivo mediator of TSLP-mediated Th2 responses. PMID:18060034
  27. Th2 skewing is mediated by OX40L PMID:18354165
  28. TNFSF4 gene is identified as a potential candidate Sjogren's syndrome susceptibility gene. PMID:19032782
  29. OX40L may play an important role in the early phase of T cell activation and proliferation PMID:19663699

Show More

Hide All

Subcellular Location
Membrane; Single-pass type II membrane protein.
Protein Families
Tumor necrosis factor family
Database Links

UNIGENE: Mm.4994

KEGG: mmu:22164

STRING: 10090.ENSMUSP00000028024

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products