Recombinant Mouse Torsin-1A-interacting protein 1 (Tor1aip1)

Code: CSB-CF856366MO
Size:
20μg
20μg100μg
US$6947
Quantity:
Express system: in vitro E.coli expression system
Species: Mus musculus (Mouse)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
Tor1aip1
Uniprot NO.
Alternative Names
Tor1aip1; Torsin-1A-interacting protein 1; Lamina-associated polypeptide 1B; LAP1B
Species
Mus musculus (Mouse)
Source
in vitro E.coli expression system
Expression Region
1-595
Target Protein Sequence
MAGERWQAEGPGEGWAIYVTPRAPIREGRRRLDPRNGDSSDAPAYGAHPSRRGRREVRFS EEPAEVYGDFEPRAAKERSPGGRRTPPEKFRPASAGEEVRESAYNLRSRPRRQRRAQEAE EMKTRRSARLEQHSQQPQLSPATSGRGLRDSPSSSEDREEDEPSSRPVTSQTASKKTLRT PEASVMNEDPISNLCRPPLRSPRLDSTYQTNGNTKTNEREATIVQQVNFFEEGETEDDLE SSYSDITIRARSSDSLESRDEATPAAGNHPDSLRGLPHNQDFPAHENQPLLLTSGCQENP QEWVDRAVRMRSRMAYNNIQKSNFGNQSPSTSRPQSAIHHPNEPSVKIKWWLLGLVAILA VGLFWFFHTPAVETTAVQEFQNQMKQLQSKYQSQNEKLWKRGTTFLEKHLNSSLPRPQPA ILLLTAAQDAAEVLKCLSEQIADAYSSFRSVRAIRIDGAGKAAQDSDLVKHEVDQELTDG FKNGQNAAVVHRFESLPAGSTLIFYKYCDHENAAFKDVALVLTVLLEEKTLEASLGLKEI EEKVRDFLKVKFTSSSTASSYNHMDPDKLNGLWSRISHLVLPVQPENTLKAGSCL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Required for nuclear membrane integrity. Induces TOR1A and TOR1B ATPase activity and is required for their location on the nuclear membrane. Binds to A- and B-type lamins. Possible role in membrane attachment and assembly of the nuclear lamina.
Gene References into Functions
  1. LAP1 interacts physically and functionally with emerin and plays an essential and selective role in skeletal muscle maintenance. PMID:24055652

Show More

Hide All

Subcellular Location
Nucleus inner membrane; Single-pass membrane protein.
Protein Families
TOR1AIP family
Tissue Specificity
Expressed in the spinal cord and liver (at protein level).
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products