MWPNGTSLGACFRPVNITLQERRAIASPWFAASFCALGLGSNLLALSVLAGARPGAGPRS SFLALLCGLVLTDFLGLLVTGAIVASQHAALLDWRATDPSCRLCYFMGVAMVFFGLCPLL LGAAMASERFVGITRPFSRPTATSRRAWATVGLVWVAAGALGLLPLLGLGRYSVQYPGSW CFLTLGTQRGDVVFGLIFALLGSASVGLSLLLNTVSVATLCRVYHTREATQRPRDCEVEM MVQLVGIMVVATVCWMPLLVFIMQTLLQTPPVMSFSGQLLRATEHQLLIYLRVATWNQIL DPWVYILFRRSVLRRLHPRFSSQLQAVSLRRPPAQAMLSGP
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Receptor for thromboxane A2 (TXA2), a potent stimulator of platelet aggregation. The activity of this receptor is mediated by a G-protein that activates a phosphatidylinositol-calcium second messenger system. In the kidney, the binding of TXA2 to glomerular TP receptors causes intense vasoconstriction. Activates phospholipase C and adenylyl cyclase.
Gene References into Functions
The results suggest that EP3 along with TP contributes to vasoconstrictor responses evoked by PGI2, and hence imply a novel mechanism for endothelial cyclooxygenase metabolites (which consist mainly of PGI2) in regulating vascular functions.PMID:28165064
platelet GP6 and thromboxane A2 receptor have a role in promoting inflammatory macrophage phenotype in skin inflammationPMID:27818280
Genetic deletion of thromboxane receptor in adipose-derived stromal cells accelerated endothelial cell differentiation.PMID:26957525
PKCalpha deficiency leads to pulmonary vascular hyperresponsiveness to TXA2, possibly via increased pulmonary arterial TP receptor expression.PMID:26890419
Uridine adenosine tetraphosphate induced aortic contraction depends on activation of TX synthase and thromboxane A2 receptor, which partially requires the activation of P2X1R through an endothelium-dependent mechanism.PMID:25921923
It is an active player in the pathogenesis of Alzheimer's disease.PMID:25457549
Adhesion of platelets through thromboxane A receptor signaling facilitates liver repair during acute chemical-induced hepatotoxicity.PMID:25921763
The results indicate that the beta1-subunit can form a tripartite complex with TP and MaxiKalpha, has the ability to associate with each protein independently.PMID:23255603
Blocking the expression of the thromboxane receptor significantly suppresses the prothrombotic effect of C-reactive protein.PMID:22879580
The thromboxane A(2) receptor agonist 11-deoxy PGF(2alpha) can partially alleviate embryo crowding in the Lpar3((-/-)) females and embryo crowding likely contributes to reduced litter size in the Lpar3((-/-)) females.PMID:22222195
We show here that thromboxane receptor in the striatum locally facilitates dopamine overflow.PMID:21749493
thromboxane A2 receptor signalling does not contribute critically to the pathogenesis of ischemic acute kidney injuryPMID:21449636
Thromboxane A2 receptor activation via PKC-zeta-mediated NAD(P)H oxidase activation increases superoxide and peroxynitrite, resulting in eNOS uncoupling in endothelial cells.PMID:20947827
Genetic variations exist in this protein in platelet function disorders.PMID:20162250
thromboxane synthase, prostacyclin synthase and thromboxane receptor have roles in atherosclerotic lesions and correlate with plaque compositionPMID:19735918
Thromboxane A2 (TXA2)-mediated platelet secretion and aggregation are important in thrombosis and the stable TXA2 analogue, U46619, induces two waves of platelet secretion, each of which precedes a distinct wave of platelet aggregationPMID:12796499
Activation of TP receptors promotes T cell proliferation, and contributes to immune-mediated tissue injury.PMID:14662837
Thromboxane A2 receptor has a role in the pathogenesis of angiotensin II-dependent hypertension.PMID:14718360
TP -/- mice have a basal increase in renal vascular resistance and filtration fraction associated with reactive oxygen species.PMID:15213069
TXA2 promotes and PGI2 prevents the initiation and progression of atherogenesis through control of platelet activation and leukocyte-endothelial cell interaction in Apolipoprotein e deficient mice.PMID:15372102
Baseline systolic blood pressure did not differ between TP(-/-) and TP(+/+) mice.PMID:15635218
Endothelial cells genetically lacking thromboxand receptor show reduced inflammatory responses when stimulated with isoprostane F2alpha-III but not other oxidized lipids.PMID:16267259
Endogenous activation of TXA2 receptor by eicosanoids did not modulate spontaneous neovascularization in the setting of ischemia.PMID:16385086
Increased responsiveness of thromboxane A(2) receptors occurs in diabetic ApoE-KO mouse kidneys.PMID:17942572
blockage of thromboxane receptors provoked embolus formation in wildtype bloodPMID:18000613
12/15LO- and TxA(2) receptor-mediated pro-atherogenic effects are two distinct pathwaysPMID:18206890
COX-1 contributes to the enhanced formation of both PGI(2) and TXA(2) in atherosclerosis, and to the development of the diseasePMID:18514659
in L-NAME hypertension, TP receptors contribute to elevated blood pressure and cardiac hypertrophy; In this model, TP receptors also provided unexpected protection against kidney injury.PMID:18684890
Demonstrate that isoprostanes inhibit angiogenesis via activation of the TBXA2R.PMID:18802021
thromboxane receptor knockout mice showed normal pain behavior in all testsPMID:18938093
the results from the present and previous studies suggest an autocrine loop, involving cyclooxygenase-2, thromboxane A synthase, and thromboxane A2 and its receptor, in cyclooxygenase-2-dependent inhibition of StAR gene expression.PMID:19325001
Thromboxane A2 receptor stimulation impairs insulin signaling in vascular endothelial cells by selectively activating the Rho/Rho-associated kinase/LKB1/PTEN pathway.PMID:19403525