VDEQLSKSVKDKVLLPCRYNSPHEDESEDRIYWQKHDKVVLSVIAGKLKVWPEYKNRTLYDNTTYSLIILGLVLSDRGTYSCVVQKKERGTYEVKHLALVKLSIKADFSTPNITESGNPSADTKRITCFASGGFPKPRFSWLENGRELPGINTTISQDPESELYTISSQLDFNTTRNHTIKCLIKYGDAHVSEDFTWEKPPEDPPDSKNTLVLFGAGFGAVITVVVIVVIIKCFCKHRSCFRRNEASRETNNSLTFGPEEALAEQTVFL
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Involved in the costimulatory signal essential for T lymphocytes activation. T-cell proliferation and cytokine production is induced by the binding of CD28 or CTLA-4 to this receptor.
Gene References into Functions
CD80 regulates Th17 differentiation in Coxsackie virus B3-induced acute myocarditis.PMID:29039143
The study showed an association between CD80 and bone mineral density and the risk of osteoporosis.PMID:28466138
this study shows that CD80 expressed by CD8(+) T cells contributes to PD-L1-induced apoptosis of activated CD8(+) T cellsPMID:29181416
TNFalpha is a prominent mediator of renal CD80 induction and resultant albuminuria.PMID:27125280
findings do not support a role for B7-1 in podocyte biologyPMID:27528551
PD-L1 interacts with CD80 to regulate graft-versus-leukemia activity of donor CD8+ T cellsPMID:28414296
PD-1 receptor has a role in interacting with programmed cell death ligands and B7-1PMID:28270509
Meningococcal capsular polysaccharide-loaded vaccine nanoparticles induce expression of CD80.PMID:24981893
The genetic inactivation of B7.1/B7.2 deteriorates obesity-related liver steatosis and metabolic dysregulation, likely a result of the intrinsic absence of Tregs in these mice, rendering DKO mice a novel murine model of NASH.PMID:24845056
These results indicate that B7H1/CD80 interaction augments Tcon cell proliferation, IL-2 production, and expression of PD-1, which leads to increased apoptosisPMID:25488990
demonstrates that the simultaneous silencing of CD40 and CD80 genes has synergistic effects in preventing allograft rejection, and may therefore have therapeutic potential in clinical transplantationPMID:24886282
data show an important role of the adaptive immune system, in particular T cell CD80/86 costimulation molecules, in the physiological regulation of bone resorption and preservation of bone massPMID:24807557
CD80 and CD86 costimulatory molecules regulate OT-II CD4(+) T lymphocyte proliferation and cytokine response in cocultures with antigen-presenting cells derived from pregnant and pseudopregnant micePMID:24771983
The need for additional immune suppression in the intestine reflects commensal microbe-driven T-cell activation through the accessory costimulation molecules ICOSL and OX40L in B7 deprived mice.PMID:25002484
demonstrate that subcategorizing memory B cells on the basis of their expression of CD80 and PD-L2PMID:24880458
B7.1 and B7.2 molecules have equal ability to mediate host resistance to Mycobacterium tuberculosis.PMID:24099792
Data suggest that decitabine (DAC) induces CD80 expression in EL4 cells via demethylation of CpG dinucleotide sites in the promoter of CD80 gene.PMID:23671644
These studies identify CD80-Fc as an alternative and potentially more efficacious therapeutic agent for overcoming PDL1-induced immune suppression and facilitating tumor-specific immunityPMID:23918985
The activation of protective CD8 T cells requires positive B7-1/B7-2 costimulation even when suppression by Tregs and in particular, Treg-intrinsic CTLA-4 is circumvented.PMID:23744647
Macrophages from infected animals show increased expression of PDL2 and CD80 that was dependent from the sex of the host.PMID:23533995
Microglia thus isolated show high surface expression of CD11c together with the co-stimulatory molecules CD40, CD80, and CD86 that are necessary for T-cell activation.PMID:23439211
Blockade of B7-1/B7-2 in NOD.AireGW/+ mice results in fulminant, early-onset autoimmune peripheral neuropathy.PMID:23487421
Although CD70 is required for dendritic cell-mediated delay of T cell tolerance induction, CD80 and CD86 are necessary for refunctionalizing the tolerized T cells in prostate tumor tissuePMID:22798683
These data demonstrate, for the first time, that iTregs can acquire CD80 and CD86 from mDCs, and the acquisition of CD86 may enhance their suppressive function.PMID:22307040
Mixed bone marrow chimeras demonstrated a B cell-intrinsic requirement for CD80 expression for normal T(FH) cell and PC developmentPMID:22450810
Under influence of estrogen, expression of CD80 appears to be down-regulated during activation of B cells; that is, upon addition of 17beta-estradiol to cultured splenocytes, CD80 is down-regulated but IgG is up-regulated.PMID:21726119
B7-1 interactions with programmed death-1 ligand 1 (PD-L1) may be particularly important for regulating potentially pathogenic self-reactive effector T cells.PMID:21697456
B7-1 on stromal cells is a key molecule regulating IL-10 production by multifunctional Treg cells, HOZOT.PMID:20628373
Mice inoculated with H22 tumor cells expressing B7-1, B7-2 and 4-1BBL developed a strong cytotoxic T lymphocyte response and long-term immunity against wild-type tumor, suggesting a synergistic effect between the B7 and 4-1BBL costimulatory pathwaysPMID:20563597
A new immune regulation loop is revealed consisting of T cell-derived interferon-gamma, B7H1 expression by antigen-presenting cells, and B7.1 expression by regulatory T (Treg) cells in an autoimmune-like graft-versus-host disease model.PMID:21263067
Peripheral regulatory T-cell maintenance critically depends on the presence of classical dendritic cells expressing CD80/86.PMID:21267999
inhibition of PU.1 expression by short interfering RNA in bone marrow-derived dendritic cells resulted in marked down-regulation of CD80 and CD86 expressionPMID:21119111
T cell-expressed CD80, more so than CD86, plays an important role in limiting expansion of effector CD8-positive cytotoxic T lymphocytes.PMID:21115734
These data reveal a requirement for B7-mediated signaling in regulating the CMV-specific CD4 T cell response and establishing host-virus equilibrium.PMID:20980516
In the absence of CD80/86, CD4 T cell priming was intact but secondary responses to intranasal administration of vaccinia virus were reduced.PMID:21040905
T-cell costimulation via B7 ligands CD80 and CD86 is essential for development of experimental hypertension; inhibition of this process could have therapeutic benefit in the treatment of this disease.PMID:21126972
The interaction of CTLA4 and B7 inhibits T helper cell type (Th)17 differentiation in vitro and in vivo and suppresses Th17-mediated autoimmunity. Blocking the CTLA4-B7 interaction potentiates Th17 cell differentiation in vitro and in vivo.PMID:20601598
These results provide evidence that signaling delivered by B7-1 and B7-2 plays a role in determining the outcome of group B streptococcal induced arthritis, likely due to the different local secretory pattern.PMID:20114085
Covalently linked dimers of B7-1 mediate strong and persistent early events in T cell-antigen presenting cell interaction and T cell activation.PMID:20065109
B7-1 and B7-2, but not PD-L1 and PD-L2, on IL-10-treated DC and DC-derived exosomes play a critical role in immunosuppressive functions of both DC and exosomes.PMID:19757438
Direct signaling through B7-1 and B7-2 is identified as a potent regulator of IgG secretion by previously activated B cells.PMID:19933871
upregulation of CD80 and loss of constitutive CD86 expression on monocytes was associated with higher severity of illness and inflammation confirming the findings in our mouse modelPMID:19672303
Negative effect of CTLA-4 on induction of T-cell immunity in vivo to B7-1+, but not B7-2+, murine myelogenous leukemia. B7-1 was important for the induction of CD8+ T-cell immunity in the absence of CTLA-4.PMID:11877291
Simultaneous expression of allogenic class II MHC and B7.1 (CD80) molecules in A20 B-lymphoma cell line enhances tumor immunogenicity.PMID:11911464
B7-CTLA4 interaction promotes cognate destruction of tumor cells by cytotoxic T lymphocytes in vivo. B7-CD28 interaction enhances T-cell clonal expansion.PMID:11929778
CD80 is important in mediating a down-regulatory effect on CD8+ CTL development, perhaps through preferential binding to CTLA4.PMID:11937530
B7-1 in deleting pathogenic autoreactive T cells in the thymus.PMID:11956287
distinct differences in the ability of LT and LT (E112K) to enhance B7-1 and B7-2 on APC, as well as a dependence upon these costimulatory molecules for their adjuvant propertiesPMID:12165495
findings indicate that B7-1a, an alternatively spliced form of B7-1, serves as a more efficacious costimulatory molecule than B7-1 or B7-2 in the induction and maintenance of anti-tumor immune responses against a poorly immunogenic osteosarcoma cell linePMID:12174878
Differential effects of iron deficiency on the expression of CD80 and CD86 co-stimulatory receptors in mitogen-treated and untreated murine spleen cellsPMID:12210763
Show
More
Hide
All
Subcellular Location
Membrane; Single-pass type I membrane protein.
Tissue Specificity
Expressed on activated B-cells, gamma interferon stimulated monocytes and non-circulating B-cell malignancies.