Home
Product
Protein
Transmembrane Proteins
Recombinant Mouse T-cell surface glycoprotein CD3 delta chain (Cd3d)

Recombinant Mouse T-cell surface glycoprotein CD3 delta chain (Cd3d)

Code: CSB-CF004930MO

Rate （N/A）
Review （0）

Size:

20μg100μg

US$3632

Quantity:

Express system: in vitro E.coli expression system

Species: Mus musculus (Mouse)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

Cd3d

Uniprot NO.

P04235

Species

Mus musculus (Mouse)

Source

in vitro E.coli expression system

Expression Region

22-173

Target Protein Sequence

FKIQVTEYEDKVFVTCNTSVMHLDGTVEGWFAKNKTLNLGKGVLDPRGIYLCNGTEQLAKVVSSVQVHYRMCQNCVELDSGTMAGVIFIDLIATLLLALGVYCFAGHETGRPSGAAEVQALLKNEQLYQPLRDREDTQYSRLGGNWPRNKKS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Part of the TCR-CD3 complex present on T-lymphocyte cell surface that plays an essential role in adaptive immune response. When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain. Upon TCR engagement, these motifs become phosphorylated by Src family protein tyrosine kinases LCK and FYN, resulting in the activation of downstream signaling pathways. In addition of this role of signal transduction in T-cell activation, CD3D plays an essential role in thymocyte differentiation. Indeed, participates in correct intracellular TCR-CD3 complex assembly and surface expression. In absence of a functional TCR-CD3 complex, thymocytes are unable to differentiate properly. Interacts with CD4 and CD8 and thus serves to establish a functional link between the TCR and coreceptors CD4 and CD8, which is needed for activation and positive selection of CD4 or CD8 T-cells.

Gene References into Functions

Mutation of Cd3d not only impairs the proper development of amacrine cells expressing Cd3d but also those not expressing Cd3d . In contrast to effects of Major histocompatibility complex and its receptor, PirB, on other neurons, mutation of Cd3d has no effect on retinal ganglion cells death and starburst amacrine cells degeneration after optic nerve crush. PMID:28441398
Polymorphisms of the CD3delta ectodomain exist in mice,some of which lead to amino acid substitutions which cause structural changes and affect anti-CD3 antibody binding. PMID:20638133
mouse CD3delta has a T-cell specific expression pattern PMID:12324448
there is one molecule each of CD3delta and CD3gamma in the surface TCR/CD3 complex PMID:15459203
A human CD3 transgene that encodes full length CD3delta and a truncated but functional form of CD3epsilon restored the defective preTCR function in not only CD3epsilon- but CD3gamma- and CD3gammadelta-deficient mice as well. PMID:16412509
CD3delta and CD3gamma play a different role in humans and mice in pre-TCR and TCR function during alphabeta T-cell development PMID:16888097
CD3delta transgene rescues gammadelta T cell development in mice lacking both mouse CD3delta and CD3gamma. PMID:17923503
CD3gammaepsilon dimers predominated over CD3deltaepsilon dimers at the early stage of T cell development. PMID:19819020