Recombinant Mouse T-cell surface glycoprotein CD3 delta chain (Cd3d)

Code: CSB-CF004930MO
Size:
20μg
20μg100μg
US$3632
Quantity:
Express system: in vitro E.coli expression system
Species: Mus musculus (Mouse)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
Cd3d
Uniprot NO.
Species
Mus musculus (Mouse)
Source
in vitro E.coli expression system
Expression Region
22-173
Target Protein Sequence
FKIQVTEYEDKVFVTCNTSVMHLDGTVEGWFAKNKTLNLGKGVLDPRGIYLCNGTEQLAKVVSSVQVHYRMCQNCVELDSGTMAGVIFIDLIATLLLALGVYCFAGHETGRPSGAAEVQALLKNEQLYQPLRDREDTQYSRLGGNWPRNKKS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Part of the TCR-CD3 complex present on T-lymphocyte cell surface that plays an essential role in adaptive immune response. When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain. Upon TCR engagement, these motifs become phosphorylated by Src family protein tyrosine kinases LCK and FYN, resulting in the activation of downstream signaling pathways. In addition of this role of signal transduction in T-cell activation, CD3D plays an essential role in thymocyte differentiation. Indeed, participates in correct intracellular TCR-CD3 complex assembly and surface expression. In absence of a functional TCR-CD3 complex, thymocytes are unable to differentiate properly. Interacts with CD4 and CD8 and thus serves to establish a functional link between the TCR and coreceptors CD4 and CD8, which is needed for activation and positive selection of CD4 or CD8 T-cells.
Gene References into Functions
  1. Mutation of Cd3d not only impairs the proper development of amacrine cells expressing Cd3d but also those not expressing Cd3d . In contrast to effects of Major histocompatibility complex and its receptor, PirB, on other neurons, mutation of Cd3d has no effect on retinal ganglion cells death and starburst amacrine cells degeneration after optic nerve crush. PMID:28441398
  2. Polymorphisms of the CD3delta ectodomain exist in mice,some of which lead to amino acid substitutions which cause structural changes and affect anti-CD3 antibody binding. PMID:20638133
  3. mouse CD3delta has a T-cell specific expression pattern PMID:12324448
  4. there is one molecule each of CD3delta and CD3gamma in the surface TCR/CD3 complex PMID:15459203
  5. A human CD3 transgene that encodes full length CD3delta and a truncated but functional form of CD3epsilon restored the defective preTCR function in not only CD3epsilon- but CD3gamma- and CD3gammadelta-deficient mice as well. PMID:16412509
  6. CD3delta and CD3gamma play a different role in humans and mice in pre-TCR and TCR function during alphabeta T-cell development PMID:16888097
  7. CD3delta transgene rescues gammadelta T cell development in mice lacking both mouse CD3delta and CD3gamma. PMID:17923503
  8. CD3gammaepsilon dimers predominated over CD3deltaepsilon dimers at the early stage of T cell development. PMID:19819020

Show More

Hide All

Subcellular Location
Membrane; Single-pass type I membrane protein.
Database Links

UNIGENE: Mm.4527

KEGG: mmu:12500

STRING: 10090.ENSMUSP00000034602

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products