Recombinant Mouse T-cell surface antigen CD2 (Cd2)

CSB-CF004894MO
Size:
20μg
20μg100μg
US$4904
Quantity:
Express system: in vitro E.coli expression system
Species: Mus musculus (Mouse)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Orders can only be placed from within the U.S.

Product Details

Target Names
Cd2
Uniprot NO.
Species
Mus musculus (Mouse)
Source
in vitro E.coli expression system
Expression Region
23-344
Target Protein Sequence
RDNETIWGVLGHGITLNIPNFQMTDDIDEVRWVRRGTLVAEFKRKKPPFLISETYEVLANGSLKIKKPMMRNDSGTYNVMVYGTNGMTRLEKDLDVRILERVSKPMIHWECPNTTLTCAVLQGTDFELKLYQGETLLNSLPQKNMSYQWTNLNAPFKCEAINPVSKESKMEVVNCPEKGLSFYVTVGVGAGGLLLVLLVALFIFCICKRRKRNRRRKDEELEIKASRTSTVERGPKPHSTPAAAAQNSVALQAPPPPGHHLQTPGHRPLPPGHRTREHQQKKRPPPSGTQIHQQKGPPLPRPRVQPKPPCGSGDGVSLPPPN
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Description

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function
CD2 interacts with lymphocyte function-associated antigen CD58 (LFA-3) and CD48/BCM1 to mediate adhesion between T-cells and other cell types. CD2 is implicated in the triggering of T-cells, the cytoplasmic domain is implicated in the signaling function.
Gene References into Functions
  1. Ptpn22 and Cd2 Variations Are Associated with Altered Protein Expression and Susceptibility to Type 1 Diabetes PMID:26438525
  2. CD2 stimuli were mandatory for Treg cell survival with reduced Bim expression, but CD2 may not function as a direct receptor for molecules on stromal cells. PMID:23278598
  3. CD2 is important for the efficient development of CD4 single-positive thymocytes and TCR-dependent activation of mature CD4 lymph node T cells, but does not direct a particular helper T cell subset polarity. PMID:11801645
  4. This antigen is a dominant target for heart allograft responses. PMID:12201362
  5. molecular mechanism of heterophilic adhesion between the murine T-cell adhesion glycoprotein CD2 and its ligand CD48 PMID:12356317
  6. Despite normal T cell numbers, mice deficient in the costimulatory molecules CD2 and CD28 spontaneously develop Pneumocystis carinii pneumonia. PMID:12902500
  7. autoimmunity may be mediated by a combination of genes in the SLAM/CD2 family cluster PMID:15589166
  8. Analysis of the ligand-receptor pairs involved in induction of germline transcripts (Igamma2a) necessary for switch recombination revealed that expression of CD48 on B cells and ligands CD2 and CD244 on NK cells are able to stimulate Igamma2a PMID:15778370
  9. CD2 deficient mice are more resistant to T. gondii infection than wild type mice PMID:17696249
  10. nanoscale increases in CD2-CD48-mediated intermembrane spacing decrease adhesion and reorganize the immunological synapse PMID:18826951
  11. CD244 inhibition and activation depends on CD2 and phospholipase C-gamma1 PMID:19586919

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Tissue Specificity
Detected in thymus and spleen.
Database Links

  Email: support@cusabio.com
  Distributors Worldwide

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products