Cd28; T-cell-specific surface glycoprotein CD28; CD antigen CD28
Species
Mus musculus (Mouse)
Source
in vitro E.coli expression system
Expression Region
20-218
Target Protein Sequence
NKILVKQSPLLVVDSNEVSLSCRYSYNLLAKEFRASLYKGVNSDVEVCVGNGNFTYQPQFRSNAEFNCDGDFDNETVTFRLWNLHVNHTDIYFCKIEFMYPPPYLDNERSNGTIIHIKEKHLCHTQSSPKLFWALVVVAGVLFCYGLLVTVALCVIWTNSRRNRLLQSDYMNMTPRRPGLTRKPYQPYAPARDFAAYRP
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Involved in T-cell activation, the induction of cell proliferation and cytokine production and promotion of T-cell survival. Enhances the production of IL4 and IL10 in T-cells in conjunction with TCR/CD3 ligation and CD40L costimulation.
Gene References into Functions
CD28 may play a role in LPS nephropathy. Immunofluorescence colocalization analysis revealed a tight association of gammadeltaT cells with B7-1 in the kidney. High B7-1 expression was detected in podocytes treated with LPS.PMID:29862277
This work unravels a new regulatory mechanism for CD28 signaling that involves dynamic interplay between acidic phospholipids and Ca2+ to set the local electrostatic environment.PMID:29058713
CD28 signaling is required for follicular Treg cell differentiation. Treg-specific deletion of CD28 caused a reduction in TFR cell numbers and function, which resulted in increased germinal center B cells and Ab production. CD28-deficient TFR cells showed a diminished suppressive capacity.PMID:29093061
In adoptive therapy of disseminated leukemia, CD200R-CD28-transduced leukemia-specific CD8 T cells eradicated otherwise lethal disease more efficiently than wild-type cells and bypassed the requirement for interleukin-2 administration to sustain in vivo activity.PMID:29042364
Mutation of the basic clusters in the CD28 cytoplasmic domain reduced the recruitment to the CD28-Lck complex of protein kinase Ctheta; (PKCtheta;), which serves as a key effector kinase in the CD28 signaling pathway.PMID:27460989
Study shows that CD28 ligation during priming endows T cells with mitochondrial capacity that is important for future T cell responses. We speculate that CD28 temporarily restricts TXNIP and miR33 expression, and this leads to a transient induction of Cpt1a and fatty acid oxidation, which are marked by characteristic changes in mitochondria shape and structure.PMID:28919076
findings revealed a dual mechanism of monocyte and neutrophil recruitment by T cells relying on overlapping and nonoverlapping roles for the noninducible costimulatory receptor CD28 and the inflammatory cytokine TNFPMID:27183621
results are consistent with a complex pathway in which CD28 is the primary driver of Treg proliferation and CTLA-4 functions as the main brake but is also dependent on TCR signals and interactions with CD80/CD86.PMID:28053234
data suggest that mPEG PV1-Fab' acts mainly on IFN-gamma-producing CD4+ T cells and emphasize that this specific CD28 blockade strategy is a potential specific and alternative tool for the treatment of autoimmune disorders in the eye.PMID:28248972
the scaffolding role of RLTPR predominates during CD28 co-stimulation and underpins the similar function of RLTPR in human and mouse T cells.PMID:27647348
BAFF upregulates CD28/B7 and CD40/CD154 expression, and promotes the interactions between T and B cells in a BAFF-R-dependent mannerPMID:27180986
Our data show that increasing the number and activation of Treg cells by a superagonistic antibody (CD28SA) is therapeutically effective in experimental arthritis.PMID:26711629
we report that cell-intrinsic deletion of CD28 after the peak of the primary response does not affect the establishment, maintenance, or recall of long-term memory. Thus, if given sufficient time, the progeny of primed CD8(+) T cells adapt to the absence of this costimulator.PMID:27122236
Deletion of CD28 co-stimulatory signals exacerbates left ventricular remodeling and increases cardiac rupture after MI through prolongation of the inflammatory period and reduction of collagen fiber in the infarct scars.PMID:27396441
identified a new plasmacytoid dendritic cells regulatory mechanism by which the same CD28 molecule that promotes stimulation in most cellsPMID:26773151
Ndrg1 is phosphorylated and degraded by CD28 signalling in a proteasome-dependent manner.PMID:26507712
The CD4/CD8 positive lymphocyte count and the expression of CD28 and CD38 antigens in the murine schistosomiasis japonica model are reported.PMID:26002824
provide evidence that CD28 and the TCR complex regulate NF-kappaB via different signaling modules of GRB-2/VAV1 and LAT/ADAP pathways respectively.PMID:25455592
CD28 can still stimulate T cell activation in the absence of its cytosolic domain.PMID:25725801
CD3/CD28-inducible MNSFbeta-Bcl-G complex may be involved in the regulation of T cell function and survival.PMID:25180634
Virus exposure results in reduced T-cell expression of CD28.PMID:25801976
CD28 persistence is required for helper T cell polarization in response to infection.PMID:25347065
CD28 Vav motif in the B lineage was essential for the long-term maintenance of Ag-specific long-lived plasma cells populationsPMID:25833397
host CD28 signaling controlled the pathogenesis of chronic graft-versus-host disease through effects on host Tregs, whose status impacts qualitatively on the allogeneic immune responsesPMID:25825447
Data show that calcium-promoted Ras inactivator (CAPRI) C2AB domains are required for CD28 antigen inhibition of adhesion.PMID:25637021
Data suggest that attenuation of CD28 signaling is a promising therapeutic approach for mitigation of radiation-induced tissue injury.PMID:25054224
CD28 was found to participate in the process of embryo implantation.PMID:24336670
CD28-CD80 interactions control regulatory T cell motility and immunological synapse formation.PMID:25355918
CD28 costimulation is essential for conferring host protection during secondary N. brasiliensis infection.PMID:24516382
CD28 signaling uses tyrosine phosphorylation-dependent and phosphorylation-independent pathways.PMID:24048955
the critical CD28/B7 interactions, required to generate Th2 cells, may directly occur between CD4 T cells engaged with the same B cell acting as an APC.PMID:24752446
blockade of CD28 signals in the presence of preserved CTLA-4 signals results in the unique up-regulation of 2B4 on primary CD8(+) effectors, and that this 2B4 expression plays a critical functional role in controlling antigen-specific T8 cell responsesPMID:24493803
Here, we targeted CD28 with siRNA to determine the role of the signaling pathway in the preservation of ultraviolet B induced skin alterations.PMID:24042341
Concurrent ablation of the CD28-activated Tec family kinase ITK does not block spontaneous T cell activation but instead causes self-reactive Ctla4(-/-) T cells to accumulate in secondary lymphoid organs.PMID:24270545
CD28 controls NKT-cell homeostasis and the size of the innate-like CD8(+) T-cell pool.PMID:23896981
Data indicate that CD28 is dispensable for gammadelta effector T cell development and differentiation.PMID:23671671
early Ag-independent encounters are an important window for optimizing T cell responses to Ag by CD28PMID:23966623
B7-CD28 costimulatory pathways and IFN-gamma production have distinct and potentially opposing effects on T cells in the development of autoimmune peripheral neuropathy.PMID:23487421
created Treg-specific Cd28 conditional knockouts. Despite normal numbers of FOXP3+ cells, these animals accumulated large numbers of activated T cells, developed severe autoimmunity, and failed to resolve induced experimental allergic encephalomyelitis.PMID:23281398
controls Treg-cell homeostasis and functionPMID:23065717
The effects of CD28 on alternative splicing provide a newly appreciated means by which CD28 can regulate T cell responses.PMID:22768209
Lack of CD28 expression on short-lived splenic plasma cells leads to increased antibody levels and might confer survival advantage.PMID:22908331
Direct CD28 costimulation of CD8-positive T-lymphocytes is critial in their priming during primary influenza infection.PMID:22585421
Results indicate AP-1 transcription factors are involved in ICOS gene expression downstream of both TCR/CD28 signaling and cytokine receptor signaling.PMID:22585681
ligation increases macrophage suppression of T-cell proliferationPMID:22522653
B7 costimulatory antigen and CD28 interactions promote proliferation and survival of activated murine gammadelta T cells following Plasmodium infection.PMID:22732586
Mice were protected from lethal superantigen challenge by short peptide mimetics of the CD28 dimer interface and by peptides selected to compete with the superantigen for its binding site in CD28.PMID:21931534
These results suggest that TCR-initiated inside-out signaling may induce a conformational change to the extracellular domains of CD28, enabling ligand binding and initiating CD28 signaling.PMID:22068237
Data show several homologies across human, rat and mouse in the kinetic of loss of several LAgs such as CD5, CD4 and CD28.PMID:21745657
CD28 and ICOS are synergistic in promoting graft vs. host disease after bone marrow transplantation.PMID:21447398