Sdc1; Synd-1; Synd1; Syndecan-1; SYND1; CD antigen CD138
Species
Mus musculus (Mouse)
Source
in vitro E.coli expression system
Expression Region
23-311
Target Protein Sequence
QIVAVNVPPEDQDGSGDDSDNFSGSGTGALPDTLSRQTPSTWKDVWLLTATPTAPEPTSSNTETAFTSVLPAGEKPEEGEPVLHVEAEPGFTARDKEKEVTTRPRETVQLPITQRASTVRVTTAQAAVTSHPHGGMQPGLHETSAPTAPGQPDHQPPRVEGGGTSVIKEVVEDGTANQLPAGEGSGEQDFTFETSGENTAVAAVEPGLRNQPPVDEGATGASQSLLDRKEVLGGVIAGGLVGLIFAVCLVAFMLYRMKKKDEGSYSLEEPKQANGGAYQKPTKQEEFYA
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Cell surface proteoglycan that bears both heparan sulfate and chondroitin sulfate and that links the cytoskeleton to the interstitial matrix. Regulates exosome biogenesis in concert with SDCBP and PDCD6IP.
Gene References into Functions
Based on our results, we conclude that SDC1 on DC negatively regulates DC migration.PMID:28453867
findings support a key role for Sdc1 in modulating pulmonary protection by FFP after hemorrhagic shock.PMID:28107214
2-O-sulfated domains in syndecan-1 heparan sulfate halt disease progression and promote liver repair by enhancing hepatocyte survival in acetaminophen-induced liver injuryPMID:28543100
CD138 expression on fully mature Antibody secreting cells (ASCs) provides a selective survival advantage over less mature, newly minted ASCs, by enhancing pro-survival cytokine signaling.PMID:28381397
Sdc1 deficiency results in increased susceptibility to colitis-associated tumorigenesis.PMID:28350804
MMP7 shedding of syndecan-1/CXCL1 complexes functions as a checkpoint that restricts neutrophil activation at sites of epithelial injury.PMID:26934670
Data show that heparanase-1 (HPA-1) induced shedding of heparan sulfate chain from syndecan-1 (SDC-1) facilitated the release of vascular endothelial growth factor C (VEGF-C) from SDC-1/VEGF-C complex into the medium of hepatocarcinoma cell.PMID:28209511
This study indicates that, while syndecan-1 is important for providing a barrier to acute S. aureus infection in PD, it does not affect peritoneal fibrosis and angiogenesis.PMID:26832929
Data suggest a potential mechanism of diabetic enteropathy, which is depending remarkably on syndecan-1 (Sdc1) and -beta-D-glucuronidase heparanase (HPSE).PMID:25702768
Study showed the expression, distribution and function of syndecan-1 in primary sensory neurons after nerve injuryPMID:26002314
A transmembrane C-terminal fragment of syndecan-1 is generated by the metalloproteinase ADAM17 and promotes lung epithelial tumor cell migration and lung metastasis formation.PMID:25912030
The PPARgamma agonist rosiglitazone rescues Sdc1-/- intradermal adipose tissue, placing PPARgamma downstream of Sdc1 in triggering adipocyte differentiationPMID:25101993
Specific structural motifs in syndecan-1 HS promote Staphylococcus aureus corneal infection by inhibiting neutrophil CRAMP.PMID:25931123
These results demonstrate that defective motility in Sdc-1(-/-) macrophages promotes a persistent inflammatory state with relevance to the pathogenesis of atherosclerosis.PMID:25550207
Sdc1 affects arteriogenesis in response to hindlimb ischemia and is required in the local tissue environment for normal arteriogenesis.PMID:25194470
Syndecan-1 promotes vascular smooth muscle cell differentiation and quiescence.PMID:24587062
The conserved domain 2 (C2) and variable (V) regions of syndecan- 1 cytoplasmic tail mediate heparanase processing.PMID:24788042
These data show that CD138(+) cells, induced by treatment with CS, migrate into the bone marrow and may displace other antigen-specific plasma cells.PMID:24555985
studies support a key role for sdc-1 in endothelial mechanosensing and regulation of endothelial phenotype.PMID:24554698
In Sdc-1(-/-) mice, early leukocyte recruitment via the choroid plexus is enhanced, and IL-6 is elevated, which collectively results in higher numbers of the disease inducing Th17 cells in the CNS, thereby contributing to enhanced disease severity.PMID:24078687
high expression of the ppGalNAc-T13 gene generates tTn antigen on Syndecan 1, leading to enhanced invasion and metastasis via the formation of a complex consisting of integrin alpha5beta1, Syndecan 1, and MMP-9 in the glycolipid-enriched microdomain/rafts.PMID:23814067
Syndecan-1 does not appear to be a prerequisite for the existence of an endothelial glycocalyx.PMID:23428342
early differentiated CD138(high)MHCII(+) rather than terminally differentiated CD138(high)MHCII(low) plasma cells may be involved in the renal inflammatory injury in lupus, due to CXCR3 expression and IgG secretion.PMID:23520491
Clearance of triglyceride-rich lipoproteins by hepatic SDC1 is atheroprotective and mediated by multivalent binding to ApoE and ApoAV.PMID:23676495
These results suggest that insulin stimulates the association of insulin receptor with syndecan-1 and the complex formation of syndecan-1 and integrin could play an important role in ERK I/II-ALP signaling pathway in osteoblast cells.PMID:23252577
Sdc1 in the germinal niche is a key HSPG regulating the maintenance and proliferation of NPCs during cortical neurogenesis, in part by modulating the ability of NPCs to respond to Wnt ligands.PMID:22936997
The loss of syndecan-1 expression in the epithelial cell membrane is associated with tumor cell growth and invasivenessPMID:22686587
These results suggest that syndecan-1 may have a crucial role in the survival of injured motor neurons and in nerve regeneration after injury.PMID:22944346
Data suggest a mechanism for the inhibitory effects of Sdc-1 on cell growth that involves the interaction between the cytoplasmic domain of Sdc-1 and the SUMO-1 E3 ligase, Topors.PMID:22912899
did not see a significant reduction in reporter-gene transduction by papillomaviruses in syndecan-1 null micePMID:22995187
the lung epithelium requires the syndecan-1 transmembrane domain to govern cell migration and is independent from its ability to control cell adhesion via the extracellular domain.PMID:22936802
The 1.5-kb upstream region of the syndecan-1 gene was sufficient to induce its expression in dental papilla, and binding of Sp3 transcription factor may play a pivotal role in this syndecan-1 induction.PMID:22134060
Reduced Syndecan-1 is associated with severe colitis in IL-10 knockout mice.PMID:21987406
These results suggest that syndecan 1 plays a novel role in the protective effects of enteral glutamine in the postischemic gut.PMID:22706022
Data show that wildtype-syndecan-1(WT-sdc1) and unshedding-syndecan-1(uS-sdc1) are successfully constructed.PMID:22482411
syndecan-1 promotes tubular survival and repair in ischemia/reperfusion injuryPMID:22237752
The myocardial levels of expression of Sdc1 mRNA and protein increased significantly in myocardial infarction(MI); The expression of soluble Sdc1 in the sera of the rats in the MI group followed a similar patternPMID:21842422
Heparan sulfate chains of syndecan-1 regulate ectodomain shedding.PMID:22298773
Molecular functions of syndecan-1 in disease.(review)PMID:22033227
Bacillus anthracis infection contribute to the formation of thrombi consisting of aggregated bacteria, vWF, shed SDC-1, fibrin, activated platelets and fibronectin.PMID:22001909
Syndecan-1 displays a protective role in aortic aneurysm formation by modulating T cell-mediated responses.PMID:22173227
Heparanase-mediated loss of nuclear syndecan-1 enhances histone acetyltransferase (HAT) activity to promote expression of genes that drive an aggressive tumor phenotypePMID:21757697
SST0001, a chemically modified heparin, inhibits myeloma growth and angiogenesis via disruption of the heparanase/syndecan-1 axisPMID:21257720
Sdc1 shedding is activated in colitis. Heparin, which mimics Sdc1 functions, relieves colitis severity by inhibiting Sdc1 shedding and downregulating cytokines expression.PMID:20936359
previously unknown bacterial subversion mechanism where S. aureus exploits the capacity of syndecan-1 ectodomains to inhibit neutrophil-mediated bacterial killing mechanisms in an heparan sulfate-dependent manner to promote its pathogenesis in the corneaPMID:21127056
the loss of syndecan1 (sdc1) in corneal stromal cells (CSC) impacts cell migration rates, the sizes and composition of focal and fibrillar adhesions, the activation of integrins, and the assembly of fibronectin into fibrilsPMID:20580707
Zoledronic acid can inhibit the growth of KM3 cells in a dose-dependent manner and inhibit CD138 expression.PMID:19642368
Sdc1 has a protective effect during experimental colitis.PMID:20008145
MMP7 shedding of syndecan-1 facilitates wound closure by causing the alpha(2)beta(1) integrin to assume a less active conformation thereby removing restrictions to migrationPMID:19668337
Show
More
Hide
All
Subcellular Location
Membrane; Single-pass type I membrane protein. Secreted. Secreted, extracellular exosome.