MVSASRPEALAAPVTTVATLVPHNATEPASPGEGKEDAFSKLKQKFMNELHKIPLPPWALIAIAIVAVLLVVTCCFCVCKKCLFKKKNKKKGKEKGGKNAINMKDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLAVKK
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Calcium sensor that participates in triggering neurotransmitter release at the synapse. May have a regulatory role in the membrane interactions during trafficking of synaptic vesicles at the active zone of the synapse. It binds acidic phospholipids with a specificity that requires the presence of both an acidic head group and a diacyl backbone. A Ca(2+)-dependent interaction between synaptotagmin and putative receptors for activated protein kinase C has also been reported. It can bind to at least three additional proteins in a Ca(2+)-independent manner; these are neurexins, syntaxin and AP2. Plays a role in dendrite formation by melanocytes.
Gene References into Functions
Mutating Ca(2+)-coordinating aspartates in the C2A-domain localizes Doc2B permanently at the plasma membrane, and renders an upstream priming step Ca(2+)-independent, whereas a separate function in downstream priming depends on SNARE-binding, Ca(2+)-binding to the C2B-domain of Doc2B, interaction with ubMunc13-2 and the presence of synaptotagmin-1.PMID:29274147
Study showed postsynaptic localization of synaptotagmin 1, at concentrations moderately lower than, but comparable to presynaptic concentrations. It is present in significant concentrations at the postsynaptic density, pointing to the likelihood of insertion of glutamate receptors directly into the synaptic plasma membrane. Synaptotagmin 1 is reduced in postsynaptic spines after eight weeks of kainite-induced epilepsy.PMID:28686803
that reduction in the synaptotagmin 1 level and presenilin 1-synaptotagmin 1 interactions in AD brain may present molecular underpinning of the pathogenic presenilin 1 conformationPMID:28193235
Authors propose that the strong reduction of Syt2 and SV2B are key factors of the functional synaptic alteration and that the physiological downregulation of Syt1 plays a determinant role in muscle vulnerability in SMA.PMID:28173138
we identify Syt2 as a functionally important Ca(2+) sensor at fast-releasing inhibitory synapses, and show that Syt1 and Syt2 can redundantly control transmitter release at specific brain synapsesPMID:28363983
results suggest that postsynaptic Syt1 and Syt7 act as redundant Ca(2+)-sensors for Ca(2+)-dependent exocytosis of AMPA receptors during long-term potentiation, and thereby delineate a simple mechanism for the recruitment of AMPA receptors that mediates LTPPMID:28355182
demonstrates a developmental Syt1-Syt2 isoform switch at an identified synapse, a mechanism that could fine-tune the speed, reliability, and plasticity of transmitter release at fast releasing CNS synapses.PMID:27210552
the combined inactivation of all 3 E-Syt genes has no effect on mouse viability or fertility.PMID:27399837
We conclude that synaptotagmin-1 phosphorylation is an essential step in PKC-dependent potentiation of synaptic transmission, acting downstream of the two other essential DAG/PKC substrates, Munc13-1 and Munc18-1.PMID:27091977
data show that hepatic Syt1 expression is influenced by diet and hormonal milieuPMID:26709651
different structural states of syt underlie the control of distinct forms of synaptic transmission.PMID:27001899
The interaction of Dvl1 with Syt-1, which is regulated by Wnts, modulates neurotransmitter release.PMID:26400647
Data (including data from studies in knockout mice) suggest that loss of both Syt1/Syt7 decreases capacity of readily-releasable pool (RRP) of Ca2+ in synaptic vesicles without altering rate of priming into RRP; Syt1/Syt7 functions appear redundant.PMID:26437117
Syt-1 regulates Abeta levels in mouse neurons. Knockdown of endogenous Syt-1 in mouse primary neurons led to a significant reduction in both Abeta40 and Abeta42 generation.PMID:26202512
Increased expression of Syt1 in neural stem cells is essential for neurogenesis progression.PMID:24973144
This study provides new insights in how the two opposite sides of the C2B domain of Synaptotagmin-1 participate in secretory vesicle fusion, and in more upstream steps, especially vesicle docking.PMID:26490858
atomic-resolution crystal structures of Ca(2+)- and Mg(2+)-bound complexes between synaptotagmin-1 and the neuronal SNARE complexPMID:26280336
the Ca(2+) dependence of the interaction between PRIP-C2 and Syt1-C2A was attributed to Ca(2+) binding with Syt1-C2A, but not PRIP-C2, using a series of mutants prepared from both C2 domains.PMID:25242442
Tissue-specific splicing, posttranslational modification and the variation in expression might suggest a different requirement of SYT1 for the specific function in each organ.PMID:25735570
This study reveals fundamental details of how phosphorylation of Thr84 on SV2A controls its interaction with synaptotagmin-1 and implicates SV2A as a phospho-dependent chaperonePMID:25673844
The syt function is markedly affected by changes in the physical nature of the linker that connects its tandem C2 domains. Moreover, the linker mutations uncoupled syt-mediated regulation of evoked and spontaneous release.PMID:24657966
In mixed glutamatergic/GABAergic neurons, excitatory postsynaptic potential (EPSP) frequencies were increased in synaptotagmin-1-null neurons.PMID:24501351
Ca(2+)-triggered release at a synapse is due to synaptotagmins, with synaptotagmin-7 mediating a slower form of Ca(2+)-triggered release that is normally occluded by faster synaptotagmin-1-induced release but becomes manifest upon synaptotagmin-1 deletionPMID:24267651
Syt-1 SNARE-interacting domains are essential for vesicle docking, priming, and fast fusion-triggering in chromaffin cells.PMID:24005294
Synaptotagmins 1 and 2 as mediators of rapid exocytosis at nerve terminals: the dyad hypothesisPMID:23648184
APP interacts with the calcium sensor synaptotagmin-1 of synaptic vesicles and might thus play a role in the regulation of synaptic vesicle exocytosis.PMID:22731840
Data suggest that Syt1 may act as a MTOC-associated protein to play important roles in mouse oocyte spindle organization/stability, and that it is indispensable for the metaphase-anaphase transition to promote mouse oocyte meiotic maturation.PMID:22313732
The dynamics of vesicle fission during clathrin-mediated endocytosis is Ca(2)+ dependent but becomes Ca(2)+ independent in synaptotagmin 1 knock-out cells.PMID:22423098
This study demonistrated that syt1 functions as a dual Ca(2+) sensor for both endo- and exocytosis, potentially coupling these two components of the vesicle cycle.PMID:22197832
This system recapitulates some of the effects of syt mutations that alter synaptic transmission in neurons. It demonstrate that the cytoplasmic domain of syt exhibited mixed agonist/antagonist activity during regulated membrane fusion in cells.PMID:22184197
this study demonistrated that Alcohol induces synaptotagmin 1 expression in neurons via activation of heat shock factor 1PMID:21816209
A test of Syt1 exocytosis in otoferlin-deficient hippocampal neurons and Syt1-deficient inner hair cells finds no deficits in vesicle fusion.PMID:21451027
new-synthesized synaptotagmin1 following synaptic plasticity may contribute to long-lasting synaptic plasticity via positive, feedfoward mechanismsPMID:21129439
The Syt7 C2B domain structure is very similar to that of the Syt1 C2B domain and contains three Ca2+-binding sites.PMID:20824061
Transient expression of Syt1 is no longer detected in cochlear inner hair cells (IHCs) after the onset of hearing, indicating that the most common calcium-ion sensors in the central nervous system are not involved in the mature IHC ribbon synapse.PMID:20926654
Expression of Syt1 in the mouse prefrontal cortex is modulated by a sequence variant (B2 SINE indel) in the 3' UTR of Comt (catechol-O-methyltransferase).PMID:20808911
1.9-A X-ray structure of the BoNT serotype G receptor binding domain on the protein receptor synaptotagmin (Syt) I/II.PMID:20219474
intestinal epithelial Syt 1 plays an important role in cAMP-stimulated endocytosis of apical NHE3 through cAMP-dependent phosphorylation of S605 that is required for NHE3 and Syt 1 associationPMID:19926819
synaptotagmin-I expressing neuroblastoma cells require gangliosides for Botulinum neurotoxin A activityPMID:12089155
In synaptotagmin 1 knockout mice, the fast component of both Ca(2+)- and Sr(2+)-induced neurotransmitter release is impaired, suggesting that both cations partly act by binding to synaptotagmin 1.PMID:12526776
Ca2+-dependent phospholipid binding to synaptotagmin 1 mirrors the intracellular Ca2+ dependence of exocytosis.PMID:12939392
syts I and II can function as protein receptors for Botulinum neurotoxin b and mediate its entryPMID:14504267
alternative translation of synaptotagmin 1 mediates the non-classical release of fibroblast growth factor 1PMID:14559220
Synaptotagmins I and II are nerve cell receptors for botulinum neurotoxin GPMID:15123599
Synaptotagmin I synchronizes the rapid release of neurotransmitters after Ca2+ entry into presynaptic terminals and also appears to suppress the slower, asynchronous form of transmitter release.PMID:15240804
We have used point mutagenesis to determine the functional contributions to triggering synchronous neurotransmitter release of the five negatively charged aspartate residues that constitute the Ca2+-binding sites in the C2B domain of synaptotagmin I.PMID:15456828
SV2B-synaptotagmin 1 complex is involved in the regulation of synaptotagmin 1 stability and/or traffickingPMID:15466855
endocytosis is significantly impaired in the absence of SytI with the relative rates of endocytosis compared with exocytosis reduced approximately 3-fold with respect to wild typePMID:15492212
synaptotagmin 1 function requires a free C terminus, possibly because of spatial constraints at the release sitesPMID:15561725
We conclude that synaptotagmin self-oligomerization is unlikely to play any significant role in triggering synaptic vesicle exocytosis.PMID:15886015