Recombinant Mouse Succinate receptor 1 (Sucnr1)

Code: CSB-CF022921MO
Size:
20μg
20μg100μg
US$4866
Quantity:
Express system: in vitro E.coli expression system
Species: Mus musculus (Mouse)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
Sucnr1
Uniprot NO.
Alternative Names
Sucnr1; Gpr91; Succinate receptor 1; G-protein coupled receptor 91
Species
Mus musculus (Mouse)
Source
in vitro E.coli expression system
Expression Region
1-317
Target Protein Sequence
MAQNLSCENWLATEAILNKYYLSAFYAIEFIFGLLGNVTVVFGYLFCMKNWNSSNVYLFN LSISDFAFLCTLPILIKSYANDKGTYGDVLCISNRYVLHTNLYTSILFLTFISMDRYLLM KYPFREHFLQKKEFAILISLAVWALVTLEVLPMLTFINSVPKEEGSNCIDYASSGNPEHN LIYSLCLTLLGFLIPLSVMCFFYYKMVVFLKRRSQQQATALPLDKPQRLVVLAVVIFSIL FTPYHIMRNLRIASRLDSWPQGCTQKAIKSIYTLTRPLAFLNSAINPIFYFLMGDHYREM LISKFRQYFKSLTSFRT
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Receptor for succinate.
Gene References into Functions
  1. Succinate accumulation impairs cardiac pyruvate dehydrogenase activity through GRP91-dependent and independent signaling pathways: Therapeutic effects of ginsenoside Rb1. PMID:28736181
  2. Succinate functions as an extracellular ligand through binding to its specific receptor on osteoclastic lineage cells and stimulates osteoclastogenesis in vitro and in vivo. Strategies inhibiting Sucnr1 activation inhibit osteoclastogenesis. PMID:28561074
  3. activation of SUCNR1 in macrophages is important for both infiltration and inflammation of adipose tissue in obesity PMID:28382382
  4. This study shows that metformin can attenuate activation of HSCs by activating the AMPK pathway and inhibiting the succinate-GPR91 pathway. Metformin has therapeutic potential for treating steatohepatitis and liver fibrosis. PMID:29278707
  5. This study reports the expression of GPR91 on mouse and human mast cells and reveals a hyperactive behavior of mouse Sucnr1-/- mast cells in a mechanistic in vivo model of skin inflammation. PMID:27527650
  6. Sucnr1 knockout mice had increased energy expenditure, less white adipose tissue, and improved glucose buffering compared with controls. They became progressively hyperglycemic and failed to secrete insulin. Sucrn1 may be a sensor for dietary energy. PMID:25352636
  7. These findings suggest that deficiency in SUCNR1 is a possible contributing factor to the pathogenesis of dry age-related macular degeneration. PMID:23833031
  8. GPR91 is expressed in the retinal pigment epithelium with specific localization to the apical membrane, indicating that succinate in the subretinal space serves as the GPR91 agonist PMID:21357408
  9. SUCNR1 is located in the luminal membrane of macula densa cells of the juxtaglomerular apparatus in close proximity to renin-producing granular cells, the cortical thick ascending limb, and cortical and inner medullary collecting duct cells. PMID:19776718
  10. GPR91, a previously orphan G-protein-coupled receptor, functions as a receptor for the citric acid cycle intermediate succinate PMID:15141213
  11. Release of the prohypertensive hormone renin by the kidney, triggered by high levels of glucose, is mediated by a succinate / GPR91 paracrine signaling cascade in the glomerular endothelium. PMID:18535668
  12. Macul densa cells can sense alterations in local tissue metabolism via accumulation of tubular succinate and GPR91 signaling. PMID:19389848

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Predominantly expressed in the kidney (proximal and distal tubules and the juxtaglomerular apparatus). Weakly expressed in liver, spleen and small intestine.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products