MDNVLPVDSDLFPNTSTNTSESNQFVQPTWQIVLWAAAYTVIVVTSVVGNVVVIWIILAH KRMRTVTNYFLVNLAFAEACMAAFNTVVNFTYAVHNVWYYGLFYCKFHNFFPIAALFASI YSMTAVAFDRYMAIIHPLQPRLSATATKVVIFVIWVLALLLAFPQGYYSTTETMPSRVVC MIEWPEHPNRTYEKAYHICVTVLIYFLPLLVIGYAYTVVGITLWASEIPGDSSDRYHEQV SAKRKVVKMMIVVVCTFAICWLPFHIFFLLPYINPDLYLKKFIQQVYLASMWLAMSSTMY NPIIYCCLNDRFRLGFKHAFRCCPFISAGDYEGLEMKSTRYLQTQSSVYKVSRLETTIST VVGAHEDEPEEGPKATPSSLDLTSNGSSRSNSKTMTESSSFYSNMLA
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
This is a receptor for the tachykinin neuropeptide substance P. It is probably associated with G proteins that activate a phosphatidylinositol-calcium second messenger system. The rank order of affinity of this receptor to tachykinins is: substance P > substance K > neuromedin K.
Gene References into Functions
BoNT/A antinociceptive activity is dependent on integrity of SP/NKA and NK1R.PMID:28673722
results indicate the contribution of NK1R signaling in maintaining the homeostasis of the ocular surface under steady-state condition, and that the lack of functional NK1R increases the susceptibility of eyes to develop severe herpes stromal keratitis upon ocular HSV-1 infectionPMID:27798158
the NK1R-CreER mouse line is a valuable new tool for conditional gene manipulation enabling the visualization and manipulation of cells that express NK1R.PMID:27712014
NK1R-/- mice did not exhibit excessive false alarms, compared with wildtypes (response disinhibition) but, as in the 5-Choice ContinuousPerformance Test, they exhibited more perseverative responses throughout the testPMID:26522842
NK1R-expressing dorsal horn neurons play a major role in the expression of symptoms of chronic itch.PMID:25830923
The results of this study indicated that certain behaviours, disrupted in ADHD, are influenced by an interaction between the BRAS and NK1R, and suggest that ACE inhibitors could provide a novel treatment for this disorder.PMID:25703442
the hyperactivity, perseveration and, possibly, inattentiveness of NK1R-/- mice is a direct consequence of a lack of functional NK1RPMID:25558794
Arsenic may initiate endothelial dysfunction, resulting in vascular leakage in response to vasoactive agents.PMID:24448713
NK1-R expression in the trachea, bronchus, and lung tissue increased in MP-infected BALB/c mice, which may explain why wheezing occurs after MP infection.PMID:25366726
The behavioural response of mice lacking NK1r to guanfacine resembles its clinical profile in treatment of ADHDPMID:25074741
Together, our findings revealed a critical role of microglial NOX2 in mediating the neuroinflammatory and dopaminergic neurodegenerative effects of SP, which may provide new insights into the pathogenesis of PD.PMID:25209287
Both PACAP and SP/NKA, but not NK1 receptors participate in normal motor coordination.PMID:23499760
obese-asthma phenotype in mice is accompanied by increased expression of NK1-R on adipose tissues and lung epithelium, reflecting that SP released during inflammation may act directly on these tissues. Blocking NK1-R affects lymphangiogenesisPMID:23792204
bone marrow taken from NK-1R deficient mice (Tacr1(-/-)) showed lineage specific B and T cell engraftment deficits compared to wild-type competitor bone marrow cellsPMID:23516556
Data indicate that NK1R-dendritic cells (DCs) promote cellular immunity that requires IL-12p70.PMID:23365459
Data from knockout mice suggest that disruption of NK1R signaling in attention deficit hyperactivity disorder could lead to drug resistance to calcium channel blockers specific for L-type channels.PMID:22884624
By activation of the NK1R receptors, it is possible to up-regulate the expression of substance P and NK1R in a protein kinase C, mitogen activated protein kinase, nuclear factor kappa b dependant pathway.PMID:22040127
male TACR1 (-/-) mice exhibited blunted approach behavior toward females following the initial interaction compared with C57BL/6 mice. NK-1R signaling may therefore play an important role in pheromone-induced sexual behavior.PMID:22471406
This review presented that the NK-1 RECEPTOR knockout mice show a correlation between 5-HT firing rate andPMID:23089640
The present studies indicate that alterations in substance P/NK1 receptor system underlie, at least in part, the behavioural and monoaminergic changes in this animal model of depression.PMID:22155476
These results indicate that deletion of the NK1 receptor does not alter behavioural susceptibility to chronic repeated stress in mice, but accelerates adaptation of the HPA axis.PMID:22019828
assessed the effects of substance P on weight gain in response to a high-fat diet and determined glucose metabolism in Tac1-deficient (Tac1(-/-)) micePMID:22009727
Methamphetamine induces trafficking of striatal neuokinin-1 receptor which is dependent on the activity of dopamine D1 and D2 receptors.PMID:20730802
Knockdown of the NK-1R gene in bile duct ligated (BDL) mice induces a decrease in the number of large cholangiocytes (associated with enhanced biliary apoptosis) compared with BDL wild-type mice.PMID:21596993
In addition to locomotor hyperactivity, NK1R-/- mice express inattentiveness, perseveration and impulsivity in the 5-choice serial reaction-time task.PMID:21408181
results suggest that cigarette smoke produces alveolar macrophages' NK1R overexpression primarily by both promoting neurogenic substance P (SP) release and synergizing NK1R response to neurogenic SP largely via activating NF-kappaB pathwayPMID:20426532
our proposal that NK1R-/- mice offer a mouse model of ADHD was borne out by our human studies, which suggest that DNA sequence changes in and around the TACR1 gene increase susceptibility to this disorderPMID:19204064
Substance P receptor mediated macrophage responses.PMID:11727773
substance p-induced bladder inflammation was mast cell dependent and did not require NK1R expression on the mast cellPMID:12217852
splenocytes and granuloma cells from neurokinin-1 receptor knockout mice made less interferon-gamma and IgG2aPMID:12388184
Loss of NK1 receptors has little effect on chemoreceptor function in the mouse, and thus they play, at best, a minor role in the hypoxic chemoreception process.PMID:12473075
Increased respiration after hypoxia was unchanged in NK1-/- neonates but was weaker in adult NK1-/- mice. NK1 receptors aren't needed for prenatal development of the respiratory network or for increased breathing by short-lasting hypoxia in neonates.PMID:12492418
increased NK-1 receptor gene expression contributes to the development and maintenance of a hyperalgesic statePMID:12535787
Genetic elimination of substance P receptors in mice results in an increased gamma-herpesvirus burden and an altered host response.PMID:12594288
Tachykinin NK1 receptor genes are expressed in uterine cells, oocytes, ovaries and embryos from mice, and may play a role in female reproductive function.PMID:12773411
protease-activated receptor 2 agonists induced a contraction of murine intestinal smooth muscle that was mediated by nerves and requires both neurokinin 1 and 2 receptorsPMID:12801882
Restraint stress results in increased dura mater mast cell activation in C57BL mice, but not in neurokinin (NK)-1 receptor knockout mice; stress triggers mast cell activation in dura mater through the activation of NK-1 receptors.PMID:12867261
Increased time-dependent expression of the NK1 receptor occurs on bone marrow mast cells after coculture with the cytokines IL-4 and/or stem cell factor and is of functional relevance for the activation of mast cells.PMID:12902513
These observations suggest that the amygdala is an important area for the effects of substance P and the NK1 receptor in the motivational properties of opiates, as well as the control of behaviors related to anxietyPMID:12967989
NK1 receptors are important in the accurate intensity coding of suprathreshold stimuli.PMID:14614952
In an inflammatory model of complete Freund's adjuvant-induced hyperalgesia, substantial reductions in swelling, histological outcome and mechanical hyperalgesia are observed in mice lacking the NK-1 receptor.PMID:14625445
Deletion of tachykinin NK1 receptor gene does not alter respiratory network maturation but alters respiratory responses to hypoxia.PMID:14635705
Time-limited overexpression of neurokinin-1 receptors in mucosal repair tissue of corpus and antrum. Neurokinin-1 receptors may be involved in gastric wound healing.PMID:14988833
peripheral nerve injury increases the expression of substance P (NK-1) receptors in the spinal cord dorsal horn; this is correlated with heat hypersensitivity.PMID:15042514
NK-1R and NK-2R have important but differential roles in the regulation of cutaneous inflammatory responsesPMID:15084523
a significant higher number of corporra lutea in the NK1-R deficient mice in comparison to the wild-type group.PMID:15236323
We found NK1 receptors in dopaminergic amacrine cells, indicating that SP neurotransmission may be a universal feature of the circuitry of the dopaminergic amacrine cell.PMID:15381281
Effect of receptor expression on mast cell development and their association with mast cells in stomach and bladder tissues.PMID:15458971
Activation of NK1 receptors is involved in the maintenance of the inhibitory tone of substantia gelatinosa interneurons.PMID:15494183
Separate distributions and the postnatal changes in SP and NK1R suggest the possibility of another nociceptive afferent transmission mechanism, that is, volume transmission, in the Vc other than synapse-mediated transmission.PMID:15763273