Recombinant Mouse Substance-P receptor (Tacr1)

Code: CSB-CF023068MO
Size:
20μg
20μg100μg
US$5540
Quantity:
Express system: in vitro E.coli expression system
Species: Mus musculus (Mouse)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
Tacr1
Uniprot NO.
Alternative Names
Tacr1; Tac1r; Substance-P receptor; SPR; NK-1 receptor; NK-1R; Tachykinin receptor 1
Species
Mus musculus (Mouse)
Source
in vitro E.coli expression system
Expression Region
1-407
Target Protein Sequence
MDNVLPVDSDLFPNTSTNTSESNQFVQPTWQIVLWAAAYTVIVVTSVVGNVVVIWIILAH KRMRTVTNYFLVNLAFAEACMAAFNTVVNFTYAVHNVWYYGLFYCKFHNFFPIAALFASI YSMTAVAFDRYMAIIHPLQPRLSATATKVVIFVIWVLALLLAFPQGYYSTTETMPSRVVC MIEWPEHPNRTYEKAYHICVTVLIYFLPLLVIGYAYTVVGITLWASEIPGDSSDRYHEQV SAKRKVVKMMIVVVCTFAICWLPFHIFFLLPYINPDLYLKKFIQQVYLASMWLAMSSTMY NPIIYCCLNDRFRLGFKHAFRCCPFISAGDYEGLEMKSTRYLQTQSSVYKVSRLETTIST VVGAHEDEPEEGPKATPSSLDLTSNGSSRSNSKTMTESSSFYSNMLA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
This is a receptor for the tachykinin neuropeptide substance P. It is probably associated with G proteins that activate a phosphatidylinositol-calcium second messenger system. The rank order of affinity of this receptor to tachykinins is: substance P > substance K > neuromedin K.
Gene References into Functions
  1. BoNT/A antinociceptive activity is dependent on integrity of SP/NKA and NK1R. PMID:28673722
  2. results indicate the contribution of NK1R signaling in maintaining the homeostasis of the ocular surface under steady-state condition, and that the lack of functional NK1R increases the susceptibility of eyes to develop severe herpes stromal keratitis upon ocular HSV-1 infection PMID:27798158
  3. the NK1R-CreER mouse line is a valuable new tool for conditional gene manipulation enabling the visualization and manipulation of cells that express NK1R. PMID:27712014
  4. NK1R-/- mice did not exhibit excessive false alarms, compared with wildtypes (response disinhibition) but, as in the 5-Choice ContinuousPerformance Test, they exhibited more perseverative responses throughout the test PMID:26522842
  5. NK1R-expressing dorsal horn neurons play a major role in the expression of symptoms of chronic itch. PMID:25830923
  6. The results of this study indicated that certain behaviours, disrupted in ADHD, are influenced by an interaction between the BRAS and NK1R, and suggest that ACE inhibitors could provide a novel treatment for this disorder. PMID:25703442
  7. the hyperactivity, perseveration and, possibly, inattentiveness of NK1R-/- mice is a direct consequence of a lack of functional NK1R PMID:25558794
  8. Arsenic may initiate endothelial dysfunction, resulting in vascular leakage in response to vasoactive agents. PMID:24448713
  9. NK1-R expression in the trachea, bronchus, and lung tissue increased in MP-infected BALB/c mice, which may explain why wheezing occurs after MP infection. PMID:25366726
  10. The behavioural response of mice lacking NK1r to guanfacine resembles its clinical profile in treatment of ADHD PMID:25074741
  11. Together, our findings revealed a critical role of microglial NOX2 in mediating the neuroinflammatory and dopaminergic neurodegenerative effects of SP, which may provide new insights into the pathogenesis of PD. PMID:25209287
  12. Both PACAP and SP/NKA, but not NK1 receptors participate in normal motor coordination. PMID:23499760
  13. obese-asthma phenotype in mice is accompanied by increased expression of NK1-R on adipose tissues and lung epithelium, reflecting that SP released during inflammation may act directly on these tissues. Blocking NK1-R affects lymphangiogenesis PMID:23792204
  14. bone marrow taken from NK-1R deficient mice (Tacr1(-/-)) showed lineage specific B and T cell engraftment deficits compared to wild-type competitor bone marrow cells PMID:23516556
  15. Data indicate that NK1R-dendritic cells (DCs) promote cellular immunity that requires IL-12p70. PMID:23365459
  16. Data from knockout mice suggest that disruption of NK1R signaling in attention deficit hyperactivity disorder could lead to drug resistance to calcium channel blockers specific for L-type channels. PMID:22884624
  17. By activation of the NK1R receptors, it is possible to up-regulate the expression of substance P and NK1R in a protein kinase C, mitogen activated protein kinase, nuclear factor kappa b dependant pathway. PMID:22040127
  18. male TACR1 (-/-) mice exhibited blunted approach behavior toward females following the initial interaction compared with C57BL/6 mice. NK-1R signaling may therefore play an important role in pheromone-induced sexual behavior. PMID:22471406
  19. This review presented that the NK-1 RECEPTOR knockout mice show a correlation between 5-HT firing rate and PMID:23089640
  20. The present studies indicate that alterations in substance P/NK1 receptor system underlie, at least in part, the behavioural and monoaminergic changes in this animal model of depression. PMID:22155476
  21. These results indicate that deletion of the NK1 receptor does not alter behavioural susceptibility to chronic repeated stress in mice, but accelerates adaptation of the HPA axis. PMID:22019828
  22. assessed the effects of substance P on weight gain in response to a high-fat diet and determined glucose metabolism in Tac1-deficient (Tac1(-/-)) mice PMID:22009727
  23. Methamphetamine induces trafficking of striatal neuokinin-1 receptor which is dependent on the activity of dopamine D1 and D2 receptors. PMID:20730802
  24. Knockdown of the NK-1R gene in bile duct ligated (BDL) mice induces a decrease in the number of large cholangiocytes (associated with enhanced biliary apoptosis) compared with BDL wild-type mice. PMID:21596993
  25. In addition to locomotor hyperactivity, NK1R-/- mice express inattentiveness, perseveration and impulsivity in the 5-choice serial reaction-time task. PMID:21408181
  26. results suggest that cigarette smoke produces alveolar macrophages' NK1R overexpression primarily by both promoting neurogenic substance P (SP) release and synergizing NK1R response to neurogenic SP largely via activating NF-kappaB pathway PMID:20426532
  27. our proposal that NK1R-/- mice offer a mouse model of ADHD was borne out by our human studies, which suggest that DNA sequence changes in and around the TACR1 gene increase susceptibility to this disorder PMID:19204064
  28. Substance P receptor mediated macrophage responses. PMID:11727773
  29. substance p-induced bladder inflammation was mast cell dependent and did not require NK1R expression on the mast cell PMID:12217852
  30. splenocytes and granuloma cells from neurokinin-1 receptor knockout mice made less interferon-gamma and IgG2a PMID:12388184
  31. Loss of NK1 receptors has little effect on chemoreceptor function in the mouse, and thus they play, at best, a minor role in the hypoxic chemoreception process. PMID:12473075
  32. Increased respiration after hypoxia was unchanged in NK1-/- neonates but was weaker in adult NK1-/- mice. NK1 receptors aren't needed for prenatal development of the respiratory network or for increased breathing by short-lasting hypoxia in neonates. PMID:12492418
  33. increased NK-1 receptor gene expression contributes to the development and maintenance of a hyperalgesic state PMID:12535787
  34. Genetic elimination of substance P receptors in mice results in an increased gamma-herpesvirus burden and an altered host response. PMID:12594288
  35. Tachykinin NK1 receptor genes are expressed in uterine cells, oocytes, ovaries and embryos from mice, and may play a role in female reproductive function. PMID:12773411
  36. protease-activated receptor 2 agonists induced a contraction of murine intestinal smooth muscle that was mediated by nerves and requires both neurokinin 1 and 2 receptors PMID:12801882
  37. Restraint stress results in increased dura mater mast cell activation in C57BL mice, but not in neurokinin (NK)-1 receptor knockout mice; stress triggers mast cell activation in dura mater through the activation of NK-1 receptors. PMID:12867261
  38. Increased time-dependent expression of the NK1 receptor occurs on bone marrow mast cells after coculture with the cytokines IL-4 and/or stem cell factor and is of functional relevance for the activation of mast cells. PMID:12902513
  39. These observations suggest that the amygdala is an important area for the effects of substance P and the NK1 receptor in the motivational properties of opiates, as well as the control of behaviors related to anxiety PMID:12967989
  40. NK1 receptors are important in the accurate intensity coding of suprathreshold stimuli. PMID:14614952
  41. In an inflammatory model of complete Freund's adjuvant-induced hyperalgesia, substantial reductions in swelling, histological outcome and mechanical hyperalgesia are observed in mice lacking the NK-1 receptor. PMID:14625445
  42. Deletion of tachykinin NK1 receptor gene does not alter respiratory network maturation but alters respiratory responses to hypoxia. PMID:14635705
  43. Time-limited overexpression of neurokinin-1 receptors in mucosal repair tissue of corpus and antrum. Neurokinin-1 receptors may be involved in gastric wound healing. PMID:14988833
  44. peripheral nerve injury increases the expression of substance P (NK-1) receptors in the spinal cord dorsal horn; this is correlated with heat hypersensitivity. PMID:15042514
  45. NK-1R and NK-2R have important but differential roles in the regulation of cutaneous inflammatory responses PMID:15084523
  46. a significant higher number of corporra lutea in the NK1-R deficient mice in comparison to the wild-type group. PMID:15236323
  47. We found NK1 receptors in dopaminergic amacrine cells, indicating that SP neurotransmission may be a universal feature of the circuitry of the dopaminergic amacrine cell. PMID:15381281
  48. Effect of receptor expression on mast cell development and their association with mast cells in stomach and bladder tissues. PMID:15458971
  49. Activation of NK1 receptors is involved in the maintenance of the inhibitory tone of substantia gelatinosa interneurons. PMID:15494183
  50. Separate distributions and the postnatal changes in SP and NK1R suggest the possibility of another nociceptive afferent transmission mechanism, that is, volume transmission, in the Vc other than synapse-mediated transmission. PMID:15763273

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Database Links

UNIGENE: Mm.8055

KEGG: mmu:21336

STRING: 10090.ENSMUSP00000032122

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products