Home
Product
Protein
Transmembrane Proteins
Recombinant Mouse Sterol O-acyltransferase 1 (Soat1)

Recombinant Mouse Sterol O-acyltransferase 1 (Soat1)

Code: CSB-CF022385MO

Rate （N/A）
Review （0）

Size:

20μg100μg

US$6535

Quantity:

Express system: in vitro E.coli expression system

Species: Mus musculus (Mouse)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

Soat1

Uniprot NO.

Q61263

Alternative Names

Soat1; Acact; Sterol O-acyltransferase 1; Acyl-coenzyme A:cholesterol acyltransferase 1; ACAT-1; Cholesterol acyltransferase 1

Species

Mus musculus (Mouse)

Source

in vitro E.coli expression system

Expression Region

1-540

Target Protein Sequence

MSLRNRLSKSGENPEQDEAQKNFMDTYRNGHITMKQLIAKKRLLAAEAEELKPLFMKEVG CHFDDFVTNLIEKSASLDNGGCALTTFSILEEMKKNHRAKDLRAPPEQGKIFISRQSLLD ELFEVDHIRTIYHMFIALLILFVLSTIVVDYIDEGRLVLEFNLLAYAFGKFPTVIWTWWA MFLSTLSIPYFLFQRWAHGYSKSSHPLIYSLVHGLLFLVFQLGVLGFVPTYVVLAYTLPP ASRFILILEQIRLIMKAHSFVRENIPRVLNAAKEKSSKDPLPTVNQYLYFLFAPTLIYRD NYPRTPTVRWGYVAMQFLQVFGCLFYVYYIFERLCAPLFRNIKQEPFSARVLVLCVFNSI LPGVLILFLSFFAFLHCWLNAFAEMLRFGDRMFYKDWWNSTSYSNYYRTWNVVVHDWLYY YVYKDLLWFFSKRFKSAAMLAVFALSAVVHEYALAICLSYFYPVLFVLFMFFGMAFNFIV NDSRKRPIWNIMVWASLFLGYGLILCFYSQEWYARQHCPLKNPTFLDYVRPRTWTCRYVF
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Catalyzes the formation of fatty acid-cholesterol esters, which are less soluble in membranes than cholesterol. Plays a role in lipoprotein assembly and dietary cholesterol absorption. Utilizes oleoyl-CoA ((9Z)-octadecenoyl-CoA) preferentially as susbstrate: shows a higher activity towards an acyl-CoA substrate with a double bond at the delta-9 position (9Z) than towards saturated acyl-CoA or an unsaturated acyl-CoA with a double bond at the delta-7 (7Z) or delta-11 (11Z) positions.

Gene References into Functions

Soat-1 role in atherosclerosis PMID:29567472
SOAT1 plays an important role in hypothalamic insulin sensitivity, linked to cognitive impairment, in high fat diet-fed mice. PMID:29453986
a potential regulatory relationship between the sterol O-acetyltransferase 1 gene and Hoxc13 gene PMID:26321246
A potentially novel gene or known gene with a novel phenotype resides within this interval, which may shed light on human diseases with defects in the inner structure of the hair fibre. PMID:19522984
Soat1 is a quantitative trait loci gene contributing to hyperlipidemia. PMID:22022387
soat1 had an important role in normal hair formation PMID:20574437
ACAT1 activity plays a central role in the proper trafficking of cholesterol and in cholesterol-sensing in the macrophage. PMID:16144700