MVSTSIPEVKALRSSVSDYGNYDIIVRHYNYTGKLNIGAEKDHGIKLTSVVFILICCFII LENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFLR EGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNSSRSFLLISACWVISLILGGLPIM GWNCISSLSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRKN ISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKAKTCDILYKAEYFLVLA VLNSGTNPIIYTLTNKEMRRAFIRIVSCCKCPNGDSAGKFKRPIIPGMEFSRSKSDNSSH PQKDDGDNPETIMSSGNVNSSS
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
G-protein coupled receptor for the bioactive lysosphingolipid sphingosine 1-phosphate (S1P) that seems to be coupled to the G(i) subclass of heteromeric G proteins. Signaling leads to the activation of RAC1, SRC, PTK2/FAK1 and MAP kinases. Plays an important role in cell migration, probably via its role in the reorganization of the actin cytoskeleton and the formation of lamellipodia in response to stimuli that increase the activity of the sphingosine kinase SPHK1. Required for normal chemotaxis toward sphingosine 1-phosphate. Required for normal embryonic heart development and normal cardiac morphogenesis. Plays an important role in the regulation of sprouting angiogenesis and vascular maturation. Inhibits sprouting angiogenesis to prevent excessive sprouting during blood vessel development. Required for normal egress of mature T-cells from the thymus into the blood stream and into peripheral lymphoid organs. Plays a role in the migration of osteoclast precursor cells, the regulation of bone mineralization and bone homeostasis. Plays a role in responses to oxidized 1-palmitoyl-2-arachidonoyl-sn-glycero-3-phosphocholine by pulmonary endothelial cells and in the protection against ventilator-induced lung injury.
Gene References into Functions
S1P1 deletion in cardiac hemo-vascular precursor cells leads to ventricular non-compaction cardiomyopathy.PMID:28338096
apoM-S1P-S1PR1 signaling might underlie the pathogenesis of ALI and apoM could have physiological benefits to alleviate LPS-induced ALI.PMID:29260347
analysis of dynamics and spatial specificity of S1P1 activation in a mouse modelPMID:29079828
our results indicate that the modulation of S1P1 expression and S1P/S1P1 interactions in NOD mouse thymocytes are part of the T-cell migratory disorder observed during the pathogenesis of type 1 diabetes.PMID:29757216
Study identifies functional antagonism of S1PR1 as a major mechanism for the protective effect of FTY720 in the cuprizone model and suggests pathogenic contributions of astrocyte S1PR1 signaling in primary demyelination and its potential as a therapeutic target for CNS inflammation.PMID:29193293
Collectively, these results suggest that S1PR1 acts as a major regulator of retinal neuron survival and restricts the retinal ganglion cell growth response induced by CNTF.PMID:29234527
Our data suggests that sphingosine-1-phosphate receptor 1 in macrophages plays an important role in protecting them against apoptosis in vitro and in atherosclerotic plaques in vivo, and delays diet induced atherosclerosis development in Ldlr deficient micePMID:29244772
These data suggest that brain endothelial S1P1 maintain the BBB by regulating the proper localization of tight junction proteins and raise the possibility that endothelial S1P1 inhibition may be a strategy for transient BBB opening and delivery of small molecules into the CNS.PMID:28396408
Astrocytic S1PR controls astrocyte neurotoxicity and monocyte recruitment and activation.PMID:28167760
Tonic S1P1 signaling by endogenous sphingosine-1-phosphate contributes to intracellular Ca(2+) homeostasis by maintaining basal Na+/H+ exchanger-1 activity and controls simultaneously myofibril Ca(2+) sensitivity through its inhibitory effect on adenylate cyclase.PMID:27207969
these data demonstrate that chronic inflammation modulates S1P1 expression and tissue S1P levelsPMID:27049060
promotes lymphangiogenesis and metastasis via NLRP3/IL-1beta in tumor-associated macrophagesPMID:28739604
The study suggests that vascular leakage of albumin-sized particles in ApoM deficiency is S1P- and S1P1-dependent and this dependency exacerbates the response to inflammatory stimuli.PMID:26956418
The present results suggest that Fas/S1P1 signaling via activation of NF-kappaB in osteoclast precursor cells is a key factor in the pathogenesis of rheumatoid arthritis in the temporomandibular joint.PMID:28687489
Activation of the S1P1 receptor in cardiac mast cells confers cardio-protection during cardiac mast cell degranulation.PMID:28500264
this study shows that S1P1 downregulation mirrors the strength and persistence of the TCR stimulation, limiting egress of high affinity T cells from lymph nodesPMID:27730626
After axonal damage, S1PR1 expression was decreased in retinal neuronsPMID:27309795
These results indicate a role for S1P signaling in Bordetella pertussis-mediated pathology.PMID:27815382
These results suggest that S1P signaling via S1P1 in cardiomyocytes plays a previously unknown and necessary role in heart development in mice in expansion of cardiomyocyte number and ventricular compaction.PMID:27333774
Profound depletion of S1p renders both erythrocyte and platelet pools necessary for recovery during anaphylactic shock.PMID:27582371
S1P induced chemotaxis in M1 macrophages and changed cytokine production in M2 macrophages. Phagocytosis was not affected by S1P-signalling.PMID:28367448
Data indicate that forkhead box F1 (Foxf1) deletion from endothelial cells decreases the abundance of sphingosine 1-phosphate receptor 1 (S1PR1).PMID:27095594
Study provided evidence for a role of S1P1 in regulating oligodendrocyte differentiation and developmental myelinationPMID:26662919
S1P is localized in the presynaptic regions of mature neurons and is regulated by sphingosine-1-phosphate.PMID:27098703
S1P1 receptor-selective up-regulation reduces the severity of acute graft versus host disease by inhibiting macrophage recruitment.PMID:25088224
Early after VSV infection, WT and S1PR1(-/-) effector T cells localized exclusively within the lymph node paracortex. However, in contrast to WT, S1PR1(-/-) effector T cells failed to enter the sinuses.PMID:26862175
GPER and Gankyrin might be implicated in the hormonal regulation of endometriosis and be associated with the severity of endometriosis.PMID:26193952
Sphingosine-1-Phosphate Receptor-1 Selective Agonist Enhances Collateral Growth and Protects against Subsequent Stroke.PMID:26367258
the ability of ApoM(+)HDL to act as a biased agonist on S1P1 inhibits vascular inflammation, which may partially explain the cardiovascular protective functions of HDL.PMID:26268607
Autocrine action of S1P in DJ-1 knock-out mice vascular smooth muscle cells results from the up-regulation of SPT2.PMID:25978603
S1P1 had a significant effect in corneal allograft rejection inhibition.PMID:25607596
The role of sphingosine-1-phosphate in the production of immature double-negative thymocytes in experimental and chronic Chagas disease is reported.PMID:25330249
The neuronal sphingosine-1-phosphate/S1PR1/STAT3 signalling axis plays a critical role in the control of energy homeostasis.PMID:25255053
Sphingosine-1-phosphate receptor 1 (S1PR1) was found as a new target gene of miR-155 by in vitro and in vivo studies; its expression was decreased in SLE patients and Fas(lpr/lpr) mice.PMID:25911753
S1P sensitizes ICAPS through G-protein coupled S1P1 receptor activation of Galphai-PI3K-PKC-p38 signaling pathway in sensory neuronsPMID:25431213
protective role for endothelial S1P1R against ischemic acute kidney injury most likely by regulating endothelial barrier integrity and endothelial HSP27 expressionPMID:24025642
Findings suggest that sphingosine phosphate lyase (S1P lyase) expressed in the thymic medullary perivascular spaces keeps the tissue sphingosine 1-phosphate low around the vessels and promotes thymic egress via up-regulation of S1P receptor 1 (S1P1).PMID:24343820
A novel role for moesin in regulating clathrin-dependent S1PR1 internalization through clathrin-coated vesicles formation.PMID:24358210
Regulation of endothelial S1PR1 dynamically controls vascular integrity and maturation and thus modulates angiogenesis, tumor growth, and hematogenous metastasis.PMID:24740542
S1PR1 mRNA was ubiquitously expressed in all the tissues examined, and significant differences were seen in mRNA expression between H9N2 virus infected and control mice in detected tissues.PMID:24073762
Data suggest that the sphingosine-1-phosphate receptor S1P1-mTOR signaling axis as a potential therapeutic target in hepatic injury.PMID:24567529
S1PR1 expression on macrophages might, therefore, be relevant for restoring tissue homeostasis during the resolution of inflammation.PMID:23934754
Results suggest that S1P (sphingosine 1-phosphate) induces endothelium-dependent vasorelaxation mainly through S1P(1) receptor and involves PAR-2 (proteinase activated receptor-2) transactivation.PMID:24131465
key role of Sphk1, S1PR1 and S1PR3 in angiogenesis underlying the liver fibrosis processPMID:23466305
Data indicate taht regulation of KLF2 and S1P1 (S1pr1) provides a switch that dictates whether CD8(+) T cells commit to recirculating or tissue-resident memory populations.PMID:24162775
Impaired S1P1 phosphorylation enhances TH17 polarization and exacerbates autoimmune neuroinflammation.PMID:24076635
We demonstrate that restoration of cardiac plasma membrane levels of S1PR1 produces beneficial effects that counterbalance the deleterious beta1AR overstimulation in heart failure.PMID:23969695
Activation of S1P receptor signaling pathways using KRP-203 inhibits atherosclerosis in LDLR knockout mice.PMID:23640484
A brief treatment with S1PR1 modulator KRP203 significantly prolonged islet allograft survival, whereas additional intragraft delivery of Tregs induced tolerogenic effects selective to islet alloantigens.PMID:23545505
Expressed in a wide variety of tissues with highest levels in brain, heart and spleen. Lower levels found in kidney, liver, lung, muscle, placenta, thymus, and uterus. Very low levels in intestine, stomach and testis. According to PubMed:9931453, expresse