MEMSSEQLNGSQVWVSSPFDLNGSLGPSNGSNQTEPYYDMTSNAVLTFIYFVVCVVGLCG NTLVIYVILRYAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPFGKAICRVVMT VDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPRTAKMINVAVWCVSLLVILPIMIY AGLRSNQWGRSSCTINWPGESGAWYTGFIIYAFILGFLVPLTIICLCYLFIIIKVKSSGI RVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSVAISPTPALKGMFDFVVIL TYANSCANPILYAFLSDNFKKSFQNVLCLVKVSGTEDGERSDSKQDKSRLNETTETQRTL LNGDLQTSI
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Receptor for somatostatin-14 and -28. This receptor is coupled via pertussis toxin sensitive G proteins to inhibition of adenylyl cyclase. In addition it stimulates phosphotyrosine phosphatase and PLC via pertussis toxin insensitive as well as sensitive G proteins. Inhibits calcium entry by suppressing voltage-dependent calcium channels. Acts as the functionally dominant somatostatin receptor in pancreatic alpha- and beta-cells where it mediates the inhibitory effect of somatostatin-14 on hormone secretion. Inhibits cell growth through enhancement of MAPK1 and MAPK2 phosphorylation and subsequent up-regulation of CDKN1B. Stimulates neuronal migration and axon outgrowth and may participate in neuron development and maturation during brain development. Mediates negative regulation of insulin receptor signaling through PTPN6. Inactivates SSTR3 receptor function following heterodimerization.
Gene References into Functions
Both hippocampal sst2 and sst4 receptors selectively inhibit stress-induced HPA axis activation but mediate anxiolytic and antidepressive effects through distinct mechanisms.PMID:27986975
Loss of sst2 from pancreatic tissues activates PI3K signaling via AKT, leading to activation of NF-kappaB, amplification of oncogenic KRAS signaling, increased expression of CXCL16, and pancreatic tumor formation.PMID:25683115
SST2 expression protects against gentamicin-induced auditory hair cell loss in the mammalian inner ear.PMID:25268135
Knock-down of SSTR2 leads to loss of pluripotency in murine embryonic stem cells.PMID:24998255
Inhibition of the Sstr2 receptor reversed the anticonvulsant effect mediated by cortistatin-14.PMID:24685142
OCT-P407 induces mRNA expression of SSTR-2 and caspase-3 and decreases that of VEGF in mice.PMID:24173662
The study encourages the use of liver tissue SSR2 protein and mRNA as a reliable tumor marker for liver cancerPMID:24163059
The aim of this study was to validate an animal model expressing SSTR2 and to correlate the immunohistochemical (IHC) analysis with (18)F-FDG and (68)Ga-DOTATOC uptake in vivo.PMID:23898054
SSTR2 was expressed in Kolliker's organ on E14, on cochlear duct hair cells & supporting cells on E17 and only on the organ of Corti at birth, increasing & peaking at P14 but dropping off at P21.PMID:22986312
SSTR2 was well expressed in most of the hypothalamic regions whereas it decreases significantly in ventromedial and arcuate nucleus of ApoD(-/-) mice.PMID:22581439
sst2 may protect retinal cells from hypoxia, thus implementing the background to establish potential pharmacological targets.PMID:22311350
somatostatin receptors demonstrate specific expression in HCs and supporting cells of the mouse cochlea, and that absence of SST1 alters the expression of SST2.PMID:21896184
SSTR2-based reporters can serve as reporters of gene transfer into non-small cell lung cancer.PMID:20653396
Overexpressed in endomterium inendometriosis.PMID:20739383
sst(2a) and sst(4) were respectively detected in the dentate gyrus (DG) and the CA1 subfield suggesting that their functional interactions are not mediated by direct receptor couplingPMID:19623609
Data indicate that OcF showing high-affinity binding to the sstr2.PMID:20233796
sst(2) receptors mediate inhibition of peristalsis in the jejunumPMID:11897621
The somatostatin receptor subtype 2a (SSR(2(a))) was found in the cytoplasm and the plasma membrane of catecholaminergic CAD-cells. After serum deprivation, SSR(2(a)) was up-regulated in the cells.PMID:12441163
Somatostatin 2 receptors are expressed in neurons and endocrine cells in the stomach and the small and large intestine.PMID:12442323
Sst2 activation inhibits the AMPA component of glutamatergic synaptic responses. Decrease of AMPA currents induced by octreotide requires a concomitant activation of sst2 receptors with either NMDA and/or metabotropic glutamate receptors.PMID:12509482
omatostatin regulates ductal bile formation in mice by inhibition of ductal fluid secretion, also by stimulation of ductal fluid absorption via interacting with SSTR2 on cholangiocytes, a process involving the intracellular cAMP/cGMP second messengers.PMID:12676656
In the striatum, Sstr2 expression is identified in medium spiny projection neurons restricted to the matrix compartment and in cholinergic interneurons.PMID:12752788
Evidence is provided that the overexpression of sst2 receptors has a profound impact on the sst2-mediated modulation of membrane excitability and neurotransmitter release in the mouse retina.PMID:15464758
somatostatin receptor subtype-2 is responsible for somatostatin binding in cortical and amygdaloid regionsPMID:15544857
We provide direct evidence for activation of SSTR2 by an endogenous ligand after focal ischemia, which contributes to increased SSTR2 gene expression and postischemic neurodegeneration.PMID:15601946
role of somatostatin receptor subtype 5 on somatostatin receptor subtype 2 action in pituitary tumor cellsPMID:15857828
the presence of sst(5) in the same cells modulates trafficking and cell surface regulation of sst(2A) and cellular desensitization to the effects of SRIFPMID:17272399
sst2 deficiency is associated with exaggerated jejunal afferent sensitivity to mechanical/chemical stimulation, suggesting that somatostatin plays an inhibitory role to control visceral sensitivity by interacting with the sst2 receptor.PMID:17363388
Decreased afferent responses to somatostatin receptor 2 stimulation correlated with lower expression of vagal somatostatin receptor 2 in stressed Nb-infected mice, confirming a link between molecular data and functional sequelae.PMID:17408648
Increased glucagon concentration is associated with impaired glucose control in sst2(-/-) mice, resulting from decreased hepatic glucose storage, increased glycogen breakdown, and reduced lipid accumulationPMID:17525126
Acute EAE disrupts the rat striatal SRIF receptor-effector system, providing insight into the molecular basis of EAE, leading to a better understanding of human multiple sclerosis.PMID:17630220
sst(2) may be protective against retinal angiogenesisPMID:17652715
The functional interactions between human somatostatin receptor 2 (hSSTR2) and human dopamine receptor 2 (hD2R) in both co-transfected CHO-K1 or HEK-293 cells as well as in cultured neuronal cells which express both the receptors endogenously.PMID:17706924
there is a remodeling of the neuroendocrine mechanisms that regulate acid secretion in mutant mice lacking SSTR2PMID:17974627
Data show that a reconsideration of the role of SSTR2 in the GI somatostatinergic effects is in order and further corroborate recent data on the role of other SSTR subtypes in the inflammatory effects of SOM during intestinal inflammation.PMID:18298437
The somatostatin type 2A receptor is mobile and rapidly and laterally diffuses in hippocampal neuronal membranes.PMID:18434512
SSTR2 is the predominant mediator of functional ocular antiangiogenic effects.PMID:18599562
These results demonstrate that sst(2) activation protects against retinal ischaemia. However, in the presence of sst(2) over-expression sst(2) is functionally desensitised by agonists, possibly because of sustained RGS1 levels.PMID:18624922
These results suggest that, in the adult mouse, testosterone is a major modulator of sst2A distribution on GHRH neurones.PMID:18752655