MNGTEGPNFYVPFSNVTGVVRSPFEQPQYYLAEPWQFSMLAAYMFLLIVLGFPINFLTLY VTVQHKKLRTPLNYILLNLAVADLFMVFGGFTTTLYTSLHGYFVFGPTGCNLEGFFATLG GEIALWSLVVLAIERYVVVCKPMSNFRFGENHAIMGVVFTWIMALACAAPPLVGWSRYIP EGMQCSCGIDYYTLKPEVNNESFVIYMFVVHFTIPMIVIFFCYGQLVFTVKEAAAQQQES ATTQKAEKEVTRMVIIMVIFFLICWLPYASVAFYIFTHQGSNFGPIFMTLPAFFAKSSSI YNPVIYIMLNKQFRNCMLTTLCCGKNPLGDDDASATASKTETSQVAPA
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Photoreceptor required for image-forming vision at low light intensity. Required for photoreceptor cell viability after birth. Light-induced isomerization of 11-cis to all-trans retinal triggers a conformational change that activates signaling via G-proteins. Subsequent receptor phosphorylation mediates displacement of the bound G-protein alpha subunit by the arrestin SAG and terminates signaling.
Gene References into Functions
Autosomal dominant retinitis pigmentosa rhodopsin mutant Q344X drives specific alterations in chromatin complex gene transcription.PMID:29463953
we show that OPN2 and OPN4 participate in immediate pigment darkening induced by UVA in murine normal and malignant melanocytes through a conserved common pathwayPMID:29395480
Photoactivation of rhodopsin increases near-Infrared backscattering from rods and causes lengthening of their rod outer segment.PMID:28320964
Specific visible radiation facilitates lipolysis in mature 3T3-L1 adipocytes via rhodopsin-dependent beta3-adrenergic signaling.PMID:28483278
By modifying culture conditions in the SFEBq protocol, we obtained rod-dominated 3D retinas and S- and M-opsin expressing 3D retinas.PMID:29274337
Rab8a and Rab11a Are Dispensable for Rhodopsin Transport in Mouse PhotoreceptorsPMID:27529348
This study demonstrated that Rhodopsin Phosphorylation on Dark Adaptation in Mouse Rods.PMID:27358455
Findings indicate that Rho and ROCK knockout may improve the behavior of mice and prevent MPTP-induced dopaminergic neurons damage by regulating Sema3A, PlexinA and NRP-1 in a mouse model of Parkinson's disease.PMID:27772760
The authors elucidated this dependency by showing that guanylate cyclase-1 is a novel rhodopsin-binding protein.PMID:26590321
Eliminating Cngb1 and reducing RDS leads to additive defects in RDS expression levels and rod electroretinogram (ERG) function, (e.g., Cngb1-/-/rds+/- versus rds+/- or Cngb1-/-) but not to additive defects in rod ultrastructure.PMID:26934134
These findings reveal that an early and significant pathophysiologic effect of endoplasmic reticulum stress in photoreceptors is the highly efficient elimination of misfolded rhodopsin protein.PMID:25270370
Data show that G90D1 ribozyme efficiently and specifically cleaved the mutant transcript of the G90D mutation in the rhodopsin gene while G90D2 ribozyme cleaved both WT and mutant transcript.PMID:26427453
These results provide precise genotypic information of the P23H-1 rat with additional phenotypic characterization that will serve basis for therapeutic interventions, especially for those aiming at gene editing.PMID:26009893
Data show that misfolded opsin mutants form aggregates in the endoplasmic reticulum.PMID:26358292
Data show that the step-like responses of serine-only rhodopsin reflect slow and stochastic arrestin binding.PMID:25910054
Data indicate that genomic sequences from the rhodopsin gene can improve the efficacy of rhodopsin gene therapy in the rhodopsin knockout (RKO) mouse model of retinitis pigmentosa (RP).PMID:25713057
Peripherin-2 links CNGB1 to the light-detector rhodopsin in outer segments of rod photoreceptors.PMID:24963162
p27(kip1) promotes mesenchymal migration and hinders amoeboid migration upstream of the Rho/ROCK pathway.PMID:25015295
Data indicate that the number of nanodomains present in a single disc was dependent on the number of rhodopsin molecules incorporated into the membrane.PMID:25305340
mice deficient in the TWIK-2 channel develop pulmonary hypertension between 8 and 20 weeks of age through a mechanism involving Rho-kinase.PMID:25245387
P23H mutant Rho can trigger phototransduction but Rho P23H/P23H rods are 17,000-fold less sensitive to light than Rho +/+ rods and produce abnormally fast photo-responses.PMID:24214395
During development, some rhodopsin-expressing cells are displaced to the inner retinal layers.PMID:24496510
We created the T17M RHO CASP7 and T17M RHO CHOP mice to study the impact of the CASP7 or CHOP ablations in T17M RHO retina.PMID:24664731
We examine and compare the contribution of endoplasmic reticulum stress to retinal degeneration in several vertebrate models of retinitis pigmentosa generated through expression of mutant rhodopsins.PMID:24664747
rod outer segments lengthen and its rhodopsin concentration rises to increase photon capture in darker environment.PMID:23985328
The results reveal that the volume of the rod outer segment is proportional to rhodopsin gene expression; that P23H-rhodopsin, the most common rhodopsin gene disease allele, causes cell death via a dominant-negative mechanismPMID:23185477
This study demonistrated that the Muller glia express rhodopsin in a mouse model of inherited retinal degeneration.PMID:22967839
Rhodopsin expression level affects rod outer segment morphology and photoresponse kineticsPMID:22662234
Stimulation of channel rhodopsin 2-containing fibers with millisecond flashes of blue light produces fast postsynaptic currents in tuberomammillary histamine neurons.PMID:22956835
analysis of structural, energetic, and mechanical perturbations in rhodopsin mutant that causes congenital stationary night blindnessPMID:22549882
The endoplasmic reticulum stress response is involved in retinal degeneration in mice with rhodopsin mutation T17MPMID:22589437
A new mutation in rhodopsin was identifies in a mouse model of retinal degeneration.PMID:22183357
Adeno-associated virus delivery of wild-type rhodopsin preserves retinal function in a mouse model of autosomal dominant retinitis pigmentosaPMID:21126223
Role of bulk water in hydrolysis of the rhodopsin chromophore.PMID:21460218
The amino acid residues that differ naturally between mouse and bovine rhodopsin appear to have minimal bearing on molecular interactions stabilizing structural segments and unfolding intermediates; no major differences in unfolding energy are observed.PMID:21038881
High levels of retinal docosahexaenoic acid do not protect mice expressing the VPP rhodopsin mutation from retinal degeneration.PMID:20806040
Mutations of the opsin gene lead to light-induced degeneration of photoreceptors and constitutive activation of phototransduction.PMID:20207741
Rhodopsin phosphorylation has three physiological functions: it quenches phototransduction, reduces sensitivity during light adaptation, and suppresses bleached rhodopsin activity during dark adaptation.PMID:20155952
Progressive photoreceptor degeneration, outer segment dysplasia, and rhodopsin mislocalization in mice with targeted disruption of the retinitis pigmentosa-1 (Rp1) gene.PMID:11960024
Atomic-force microscopy of rhodopsin dimers in native disc membranesPMID:12520290
structure of rhodopsin and opsin dimer in native membranesPMID:12663652
Data describe the organization of the prototypical G protein-coupled receptor rhodopsin in its native membrane by electron and atomic force microscopy.PMID:15111110
Data suggest that the differences in physiological responses measured in wild type and rhodopsin knockout mice are due to structural changes of the whole rod outer segment and not due to a lower density of rhodopsin.PMID:15337746
palmitoylation may modulate rod photoreceptor sensitivity by permitting rhodopsin to remain active for a longer periodPMID:15851469
rods generate reproducible single-photon responses; this reproducibility, consistency of amplitude & duration of rhodopsin activity, varies in a graded & systematic manner with the number but not identity of phosphorylation sites on rhodopsin's C terminusPMID:16873665
reveals how the molecular properties of rhodopsin affect the amplitude, shape, and kinetics of the rod responsePMID:17194706
A single Rho molecule is necessary and sufficient to bind Arrestin.PMID:17360618
These experiments indicate that mutations of rhodopsin( Gly90Asp ) that lead to increases in cGMP and Ca(2+) can trigger photoreceptor degeneration.PMID:17699662
A STAT3-dependent E3 ubiquitin ligase, Ubr1, was responsible for rhodopsin degradation and was up-regulated in the inflamed SOCS3-deficient retinas.PMID:18614536