Home
Product
Protein
Transmembrane Proteins
Recombinant Mouse Radiation-inducible immediate-early gene IEX-1 (Ier3)

Recombinant Mouse Radiation-inducible immediate-early gene IEX-1 (Ier3)

Code: CSB-CF011002MO

Rate （N/A）
Review （0）

Size:

20μg100μg

US$3639

Quantity:

Express system: in vitro E.coli expression system

Species: Mus musculus (Mouse)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

Ier3

Uniprot NO.

P46694

Species

Mus musculus (Mouse)

Source

in vitro E.coli expression system

Expression Region

1-160

Target Protein Sequence

MCHSRNHLHTMTGLRAPSPAPSTGPELRRGSGPEIFTFDPLPERAVVSTARLNTSRGHRKRSRRVLYPRVVRRQLPTEEPNIAKRVLFLLFAIIFCQILMAEEGVSQPLAPEDATSAVTPEPISAPITAPPVLEPLNLTSESSDYALDLKAFLQQHPAAF
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Buffer

Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

May play a role in the ERK signaling pathway by inhibiting the dephosphorylation of ERK by phosphatase PP2A-PPP2R5C holoenzyme. Acts also as an ERK downstream effector mediating survival. As a member of the NUPR1/RELB/IER3 survival pathway, may allow the development of pancreatic intraepithelial neoplasias.

Subcellular Location

Membrane; Single-pass type II membrane protein.

Protein Families

IER3 family

Tissue Specificity

Expressed predominantly in the lung, testes and the uterus.

Database Links

UNIGENE: Mm.25613

STRING: 10090.ENSMUSP00000003635

Promotions