SFFLRNPSENTFELVPLGDEEEEEKNESVLLEGRAVYLNISLPPHTPPPPFISEDASGYL TSPWLTLFMPSVYTIVFIVSLPLNVLAIAVFVLRMKVKKPAVVYMLHLAMADVLFVSVLP FKISYYFSGTDWQFGSGMCRFATAAFYGNMYASIMLMTVISIDRFLAVVYPIQSLSWRTL GRANFTCVVIWVMAIMGVVPLLLKEQTTRVPGLNITTCHDVLSENLMQGFYSYYFSAFSA IFFLVPLIVSTVCYTSIIRCLSSSAVANRSKKSRALFLSAAVFCIFIVCFGPTNVLLIVH YLFLSDSPGTEAAYFAYLLCVCVSSVSCCIDPLIYYYASSECQRHLYSILCCKESSDPNS CNSTGQLMPSKMDTCSSHLNNSIYKKLLA
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
High affinity receptor for activated thrombin coupled to G proteins that stimulate phosphoinositide hydrolysis.
Gene References into Functions
PAR-1 plays an important role in the development of diabetic nephropathy (DN) and PAR-1 might therefore be an attractive therapeutic target to pursue in DN.PMID:27618774
Experimental TCDD-elicited steatohepatitis is associated with coagulation cascade activation and PAR-1-driven hepatic inflammation and fibrosis.PMID:27613713
PAR1 in its inactive unligated state functions as a scaffold for TGFbetaRII to downregulate TGF-beta signaling, and thereby promote embryonic stem cell transition to functional endothelial cells.PMID:27866874
this study shows that poly I:C treated PAR-1-/- mice given the thrombin inhibitor dabigatran etexilate exhibited less IFNbeta and CXCL10 expression in the spleen and plasmaPMID:27820939
Brain water content in the ipsilateral hemisphere and the tumor mass were significantly lower in PAR-1 KO than WT mice at day 12 after implantation of glioma cells.PMID:26463974
The results of this study suggested that polarized microglia occur dynamically after ICH and that PAR-1 plays a role in the microglia activation and polarization.PMID:27206851
our findings define a detrimental role of thrombin-activated PAR-1 in wound healing in mice with spinal cord injuries.PMID:28122028
Thrombin upregulates LCN2 through protease-activated receptor-1 activation and causes brain damage.PMID:26869387
Matrix metalloproteinases (MMP) are effectors of hippocampal neuroplasticity in the adult central nervous system and that the MMP-1/protease-activated receptor-1 axis may play a role in neurogenesis following physiological and/or pathological stimuli.PMID:26783471
Data indicate an involvement of protease-activated receptor-1 in the neuroinflammation mediated by Eomes(+) CD4(+) T cells.PMID:26436530
Bladder PAR activation elicits urothelial MIF release and urothelial MIF receptor signaling at least partly through CXCR4 to result in abdominal hypersensitivity without overt bladder inflammationPMID:26020638
Data suggest that the pro-fibrotic effects of protease-activated receptor PAR-1 require the presence of protease-activated receptor PAR-2.PMID:25689283
Thrombin-PAR1 signaling, via nitric oxide and EPCR, promotes hematopoietic stem cell (HSC) mobilization. aPC-EPCR-PAR1 signaling promotes HSC retention in bone marrow.PMID:26457757
Colonic adenocarcinoma growth was reduced in PAR-1-deficient mice. Stromal cell-associated PAR-1 as one thrombin target important for tumor outgrowth.PMID:26238780
Interference with the thrombin-PAR1 system does not reduce the adverse effects of blood on germinal cells of the immature mouse brain.PMID:25649264
impairs host defense during pneumococcal pneumoniaPMID:23270594
this study demonstrated that PAR1-mediated protection against H. pylori gastritis requires bone marrow-derived cells.PMID:24866378
these data demonstrate a key role for PAR-1 during S. pneumoniae lung infection that is mediated, at least in part, by influencing multiple downstream inflammatory mediators.PMID:25948816
Results demonstrate that PAR1 activation alters the ability of denervated neurons to increase their excitatory synaptic strength in a homeostatic mannerPMID:25086265
Deletion of PAR-1 does not confer chondroprotection in a medial meniscus destabilization model of osteoarthritis.PMID:25200274
The absence of PAR-1 results in a slower skeletal muscle contractile phenotype, likely due to an increase in type I and a decrease in type IIb/x fiber numbers.PMID:24692104
Study examined the effect of a deficiency in PAR1 or PAR2 on oxsackievirus B3-induced myocarditis and found that PAR1 knockout mice had increased cardiac injury whereas PAR2 knockout mice had decreased cardiac injury supporting the notion that PARs modulate the innate immune response and can have both positive and negative effects on TLR-dependent responses.PMID:24759133
PAR1 signalling can contribute to the regulation of macrophage recruitment, impacting the fibrotic response of the liver to recurrent injury.PMID:24475094
PAR1 is expressed in the mouse prostate and its activation by PAR1-TF elicits immunomodulatory effects during ethanol-DNBS-induced prostatitis.PMID:24459330
These results show that endogenous PAR-1 facilitates bacterial growth and dissemination during murine melioidosis, which is associated with increased cell influxes.PMID:24239704
The findings point to experience-specific shifts in PAR1-G protein coupling in the amygdala as a novel mechanism regulating neuronal excitability and fear.PMID:23032873
Simultaneous depletion of PAR-1 and PAR-3 almost completely inhibited epithelial-mesenchymal transition in bleomycin-induced lung fibrosis.PMID:23739922
hMPV fusion protein can be cleaved by furin thus suggesting that PAR1 could have an effect on viral infectivity in addition to its immunomodulatory properties.PMID:24015257
PAR2, and not PAR1, contributes to post-ischemic blood flow restoration and collateral remodelling in a hind limb ischemia model.PMID:23637930
these data point to a novel kallikrein 6 -signaling axis in neurons that is mediated by PAR1 and PAR2 and is positioned to contribute to neurodegenerationPMID:23647384
Noncanonical MMP-1-PAR1 signaling resulted in the opposite effect and led to a dedifferentiated phenotype via a different G protein pathway. MMP-1-PAR1 significantly stimulated hyperplasia and migration of SMCs.PMID:23814055
inhibition of the SOCE downstream target CaM kinase kinase beta (CaMKKbeta) or knockdown of AMPKalpha1 suppressed PAR-1-mediated phosphorylation of p38beta and hence STIM1.PMID:23625915
PDZ-RhoGEF and LARG are essential for embryonic development and provide a link between thrombin and LPA receptors and Rho activation.PMID:23467409
Upon activation of protease activated receptor 1 (PAR1), an increase in intracellular Ca2+ concentration leads to an opening of Best1 channels and subsequent release of glutamate in cultured astrocytes.PMID:23062602
The tissue factor/thrombin/PAR-1 pathway enhances IFN-beta expression and contributes to the innate immune response during single-stranded RNA viral infection.PMID:23391721
Activating PAR1 by administering the agonist TFLLR-NH2 decreased survival and increased lung inflammation after influenza infection.PMID:23202729
PAR-1 contributes to the brain injury induced by global cerebral ischemia, which may be related to activation of mitogen-activated protein kinasesPMID:22811450
Trypsin inhibited LPS signaling PAR-independently via degradation of TLR4 accessory moleculesPMID:22771700
demonstrate that beta-adrenergic receptor stimulation leads to MMP-13 transactivation of protease-activated receptor 1 in both cardiac fibroblasts and cardiomyocytesPMID:22610965
thrombin receptor (F2r), a protease-activated G protein-coupled receptor required for vascular development, functions as a negative regulator during hematopoietic development.PMID:22521721
Study identified key molecular determinants for PAR1 interactions with G(q/11), and findings support a model where G(q/11), G(i/o) or G(12/13) each bind to distinct sites within the cytoplasmic regions of PAR1.PMID:22306780
the microbiota-induced extravascular TF-PAR1 signalling loop is a novel pathway that may be modulated to influence vascular remodelling in the small intestinePMID:22407318
PAR2 regulates the PAR1 hyperplastic response to arterial injury leading to stenosis.PMID:21940952
These findings implicate MMP-1 as an important activator of PAR1 in sepsis and suggest that therapeutics that target MMP1-PAR1 may prove beneficial in the treatment of sepsis.PMID:21591259
PAR-1 protects the host against severe Helicobacter-induced gastritis [PAR-1].PMID:19706295
RANTES may contribute to modulation of IL-13 production and PAR expression in mast cells.PMID:21074454
EPCR interacts with the ternary TF coagulation initiation complex to enable PAR1,2 signaling.PMID:21149441
VASP deficiency leads to a more profound endothelial barrier disruption and delayed recovery after activation of thrombin PAR-1 receptor.PMID:20945373
PAR-1 negatively regulates the expression of the Maspin tumor-suppressor gene in the acquisition of the metastatic melanoma phenotypePMID:21187389