Recombinant Mouse Proteinase-activated receptor 1 (F2r)

Code: CSB-CF007924MO
Size:
20μg
20μg100μg
US$5405
Quantity:
Express system: in vitro E.coli expression system
Species: Mus musculus (Mouse)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
F2r
Uniprot NO.
Alternative Names
F2r; Cf2r; Par1; Proteinase-activated receptor 1; PAR-1; Thrombin receptor
Species
Mus musculus (Mouse)
Source
in vitro E.coli expression system
Expression Region
42-430
Target Protein Sequence
SFFLRNPSENTFELVPLGDEEEEEKNESVLLEGRAVYLNISLPPHTPPPPFISEDASGYL TSPWLTLFMPSVYTIVFIVSLPLNVLAIAVFVLRMKVKKPAVVYMLHLAMADVLFVSVLP FKISYYFSGTDWQFGSGMCRFATAAFYGNMYASIMLMTVISIDRFLAVVYPIQSLSWRTL GRANFTCVVIWVMAIMGVVPLLLKEQTTRVPGLNITTCHDVLSENLMQGFYSYYFSAFSA IFFLVPLIVSTVCYTSIIRCLSSSAVANRSKKSRALFLSAAVFCIFIVCFGPTNVLLIVH YLFLSDSPGTEAAYFAYLLCVCVSSVSCCIDPLIYYYASSECQRHLYSILCCKESSDPNS CNSTGQLMPSKMDTCSSHLNNSIYKKLLA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
High affinity receptor for activated thrombin coupled to G proteins that stimulate phosphoinositide hydrolysis.
Gene References into Functions
  1. PAR-1 plays an important role in the development of diabetic nephropathy (DN) and PAR-1 might therefore be an attractive therapeutic target to pursue in DN. PMID:27618774
  2. Experimental TCDD-elicited steatohepatitis is associated with coagulation cascade activation and PAR-1-driven hepatic inflammation and fibrosis. PMID:27613713
  3. PAR1 in its inactive unligated state functions as a scaffold for TGFbetaRII to downregulate TGF-beta signaling, and thereby promote embryonic stem cell transition to functional endothelial cells. PMID:27866874
  4. this study shows that poly I:C treated PAR-1-/- mice given the thrombin inhibitor dabigatran etexilate exhibited less IFNbeta and CXCL10 expression in the spleen and plasma PMID:27820939
  5. Brain water content in the ipsilateral hemisphere and the tumor mass were significantly lower in PAR-1 KO than WT mice at day 12 after implantation of glioma cells. PMID:26463974
  6. The results of this study suggested that polarized microglia occur dynamically after ICH and that PAR-1 plays a role in the microglia activation and polarization. PMID:27206851
  7. our findings define a detrimental role of thrombin-activated PAR-1 in wound healing in mice with spinal cord injuries. PMID:28122028
  8. Thrombin upregulates LCN2 through protease-activated receptor-1 activation and causes brain damage. PMID:26869387
  9. Matrix metalloproteinases (MMP) are effectors of hippocampal neuroplasticity in the adult central nervous system and that the MMP-1/protease-activated receptor-1 axis may play a role in neurogenesis following physiological and/or pathological stimuli. PMID:26783471
  10. Data indicate an involvement of protease-activated receptor-1 in the neuroinflammation mediated by Eomes(+) CD4(+) T cells. PMID:26436530
  11. Bladder PAR activation elicits urothelial MIF release and urothelial MIF receptor signaling at least partly through CXCR4 to result in abdominal hypersensitivity without overt bladder inflammation PMID:26020638
  12. Data suggest that the pro-fibrotic effects of protease-activated receptor PAR-1 require the presence of protease-activated receptor PAR-2. PMID:25689283
  13. Thrombin-PAR1 signaling, via nitric oxide and EPCR, promotes hematopoietic stem cell (HSC) mobilization. aPC-EPCR-PAR1 signaling promotes HSC retention in bone marrow. PMID:26457757
  14. Colonic adenocarcinoma growth was reduced in PAR-1-deficient mice. Stromal cell-associated PAR-1 as one thrombin target important for tumor outgrowth. PMID:26238780
  15. Interference with the thrombin-PAR1 system does not reduce the adverse effects of blood on germinal cells of the immature mouse brain. PMID:25649264
  16. Protease activated receptor-1 deficiency diminishes bleomycin-induced skin fibrosis PMID:24842054
  17. impairs host defense during pneumococcal pneumonia PMID:23270594
  18. this study demonstrated that PAR1-mediated protection against H. pylori gastritis requires bone marrow-derived cells. PMID:24866378
  19. these data demonstrate a key role for PAR-1 during S. pneumoniae lung infection that is mediated, at least in part, by influencing multiple downstream inflammatory mediators. PMID:25948816
  20. Results demonstrate that PAR1 activation alters the ability of denervated neurons to increase their excitatory synaptic strength in a homeostatic manner PMID:25086265
  21. Deletion of PAR-1 does not confer chondroprotection in a medial meniscus destabilization model of osteoarthritis. PMID:25200274
  22. The absence of PAR-1 results in a slower skeletal muscle contractile phenotype, likely due to an increase in type I and a decrease in type IIb/x fiber numbers. PMID:24692104
  23. Study examined the effect of a deficiency in PAR1 or PAR2 on oxsackievirus B3-induced myocarditis and found that PAR1 knockout mice had increased cardiac injury whereas PAR2 knockout mice had decreased cardiac injury supporting the notion that PARs modulate the innate immune response and can have both positive and negative effects on TLR-dependent responses. PMID:24759133
  24. PAR1 signalling can contribute to the regulation of macrophage recruitment, impacting the fibrotic response of the liver to recurrent injury. PMID:24475094
  25. PAR1 is expressed in the mouse prostate and its activation by PAR1-TF elicits immunomodulatory effects during ethanol-DNBS-induced prostatitis. PMID:24459330
  26. These results show that endogenous PAR-1 facilitates bacterial growth and dissemination during murine melioidosis, which is associated with increased cell influxes. PMID:24239704
  27. The findings point to experience-specific shifts in PAR1-G protein coupling in the amygdala as a novel mechanism regulating neuronal excitability and fear. PMID:23032873
  28. Simultaneous depletion of PAR-1 and PAR-3 almost completely inhibited epithelial-mesenchymal transition in bleomycin-induced lung fibrosis. PMID:23739922
  29. hMPV fusion protein can be cleaved by furin thus suggesting that PAR1 could have an effect on viral infectivity in addition to its immunomodulatory properties. PMID:24015257
  30. PAR2, and not PAR1, contributes to post-ischemic blood flow restoration and collateral remodelling in a hind limb ischemia model. PMID:23637930
  31. these data point to a novel kallikrein 6 -signaling axis in neurons that is mediated by PAR1 and PAR2 and is positioned to contribute to neurodegeneration PMID:23647384
  32. Noncanonical MMP-1-PAR1 signaling resulted in the opposite effect and led to a dedifferentiated phenotype via a different G protein pathway. MMP-1-PAR1 significantly stimulated hyperplasia and migration of SMCs. PMID:23814055
  33. inhibition of the SOCE downstream target CaM kinase kinase beta (CaMKKbeta) or knockdown of AMPKalpha1 suppressed PAR-1-mediated phosphorylation of p38beta and hence STIM1. PMID:23625915
  34. PDZ-RhoGEF and LARG are essential for embryonic development and provide a link between thrombin and LPA receptors and Rho activation. PMID:23467409
  35. Upon activation of protease activated receptor 1 (PAR1), an increase in intracellular Ca2+ concentration leads to an opening of Best1 channels and subsequent release of glutamate in cultured astrocytes. PMID:23062602
  36. The tissue factor/thrombin/PAR-1 pathway enhances IFN-beta expression and contributes to the innate immune response during single-stranded RNA viral infection. PMID:23391721
  37. Activating PAR1 by administering the agonist TFLLR-NH2 decreased survival and increased lung inflammation after influenza infection. PMID:23202729
  38. PAR-1 contributes to the brain injury induced by global cerebral ischemia, which may be related to activation of mitogen-activated protein kinases PMID:22811450
  39. Trypsin inhibited LPS signaling PAR-independently via degradation of TLR4 accessory molecules PMID:22771700
  40. demonstrate that beta-adrenergic receptor stimulation leads to MMP-13 transactivation of protease-activated receptor 1 in both cardiac fibroblasts and cardiomyocytes PMID:22610965
  41. thrombin receptor (F2r), a protease-activated G protein-coupled receptor required for vascular development, functions as a negative regulator during hematopoietic development. PMID:22521721
  42. Study identified key molecular determinants for PAR1 interactions with G(q/11), and findings support a model where G(q/11), G(i/o) or G(12/13) each bind to distinct sites within the cytoplasmic regions of PAR1. PMID:22306780
  43. the microbiota-induced extravascular TF-PAR1 signalling loop is a novel pathway that may be modulated to influence vascular remodelling in the small intestine PMID:22407318
  44. PAR2 regulates the PAR1 hyperplastic response to arterial injury leading to stenosis. PMID:21940952
  45. These findings implicate MMP-1 as an important activator of PAR1 in sepsis and suggest that therapeutics that target MMP1-PAR1 may prove beneficial in the treatment of sepsis. PMID:21591259
  46. PAR-1 protects the host against severe Helicobacter-induced gastritis [PAR-1]. PMID:19706295
  47. RANTES may contribute to modulation of IL-13 production and PAR expression in mast cells. PMID:21074454
  48. EPCR interacts with the ternary TF coagulation initiation complex to enable PAR1,2 signaling. PMID:21149441
  49. VASP deficiency leads to a more profound endothelial barrier disruption and delayed recovery after activation of thrombin PAR-1 receptor. PMID:20945373
  50. PAR-1 negatively regulates the expression of the Maspin tumor-suppressor gene in the acquisition of the metastatic melanoma phenotype PMID:21187389

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products